-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against STK39 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 401-545 of human STK39 (Q9UEW8) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against STK39 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 401-545 of human STK39 (Q9UEW8) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-16186A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | STK39 |
| Target Synonyms | DCHT; PASK; SPAK; Ste 20 related kinase; STK39 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat, Mouse testis, Rat testis, SH-SY5Y | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 401-545 of human STK39 (Q9UEW8). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SQEKSRRVKEENPEIAVSASTIPEQIQSLSVHDSQGPPNANEDYREASSCAVNLVLRLRNSRKELNDIRFEFTPGRDTADGVSQELFSAGLVDGHDVVIVAANLQKIVDDPKALKTLTFKLASGCDGSEIPDEVKLIGFAQLSVS | Uniprot ID | Q9UEW8 |
Uniprot Id
Q9UEW8
Target Species
Human
Target Name
STK39
Target Full Name
STE20/SPS1-related proline-alanine-rich protein kinase
Target Function
May act as a mediator of stress-activated signals. Mediates the inhibition of SLC4A4, SLC26A6 as well as CFTR activities by the WNK scaffolds, probably through phosphorylation. Phosphorylates RELT.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
Protein kinase superfamily, STE Ser/Thr protein kinase family, STE20 subfamily
Target Tissue Specificity
Predominantly expressed in brain and pancreas followed by heart, lung, kidney, skeletal muscle, liver, placenta and testis.
Target Synonyms
DCHT; DKFZp686K05124; OTTHUMP00000165175; PASK; Proline alanine rich STE20 related kinase; Serine threonine kinase 39 (STE20/SPS1 homolog yeast); Serine threonine kinase 39; Serine/threonine protein kinase 39; Serine/threonine-protein kinase 39; Small intestine SPAK like kinase; SPAK; Ste 20 related kinase; Ste-20-related kinase; Ste20 like protein kinase; STE20/SPS1 homolog; STE20/SPS1 related proline alanine rich protein kinase; STE20/SPS1-related proline-alanine-rich protein kinase; STK 39; Stk39; STK39_HUMAN
Target Background
This gene encodes a serine/threonine kinase that is thought to function in the cellular stress response pathway. The kinase is activated in response to hypotonic stress, leading to phosphorylation of several cation-chloride-coupled cotransporters. The catalytically active kinase specifically activates the p38 MAP kinase pathway, and its interaction with p38 decreases upon cellular stress, suggesting that this kinase may serve as an intermediate in the response to cellular stress.
Notification