Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against STRIP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 743-837 of human STRIP1 (NP_149079.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against STRIP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 743-837 of human STRIP1 (NP_149079.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-01433A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | STRIP1 |
| Target Synonyms | FAM40A; FAR11A; STRIP1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, LO2, MCF7, Mouse brain, U-87MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 743-837 of human STRIP1 (NP_149079.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VRHRLNDDWAYGNDLDARPWDFQAEECALRANIERFNARRYDRAHSNPDFLPVDNCLQSVLGQRVDLPEDFQMNYDLWLEREVFSKPISWEELLQ | Uniprot ID | Q5VSL9 |
Uniprot Id
Q5VSL9
Target Species
Human
Target Name
STRIP1
Target Full Name
Striatin-interacting protein 1
Target Function
Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the cortical actin filament dynamics and cell shape.
Target Subcellular Location
Cytoplasm. Note=Enriched on the plasma membrane.
Target Protein Families
STRIP family
Target Synonyms
FA40A_HUMAN; fam40a; FLJ14743; KIAA1761; MGC148091; Protein FAM40A; RP4-773N10.1
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
