Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SYNPO2L was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 700-800 of human SYNPO2L (NP_001107605.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SYNPO2L was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 700-800 of human SYNPO2L (NP_001107605.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04110A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SYNPO2L |
| Target Synonyms | SYNPO2L | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 700-800 of human SYNPO2L (NP_001107605.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HVTPKTPPPMAPKTPPPMTPKTPPPVAPKPPSRGLLDGLVNGAASSAGIPEPPRLQGRGGELFAKRQSRADRYVVEGTPGPGLGPRPRSPSPTPSLPPSWK | Uniprot ID | Q9H987 |
Uniprot Id
Q9H987
Target Species
Human
Target Name
SYNPO2L
Target Full Name
Synaptopodin 2-like protein
Target Function
Actin-associated protein that may play a role in modulating actin-based shape.
Target Subcellular Location
Cytoplasm, cytoskeleton.
Target Protein Families
Synaptopodin family
Target Synonyms
Synaptopodin 2-like protein; Synpo2l; SYP2L_HUMAN
Target Background
Predicted to enable actin binding activity. Predicted to be involved in several processes, including positive regulation of Rho protein signal transduction; positive regulation of stress fiber assembly; and sarcomere organization. Located in cell junction; cytosol; and nuclear speck.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
