-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TAB2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 510-620 of human TAB2 (NP_055908.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TAB2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 510-620 of human TAB2 (NP_055908.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11698A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TAB2 |
| Target Synonyms | CHTD2; TAB-2; MAP3K7IP2; TAB2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat heart, Mouse brain, Rat kidney, Rat skeletal muscle | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 510-620 of human TAB2 (NP_055908.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TLAHVDRISETRKLSMGSDDAAYTQALLVHQKARMERLQRELEIQKKKLDKLKSEVNEMENNLTRRRLKRSNSISQIPSLEEMQQLRSCNRQLQIDIDCLTKEIDLFQARG | Uniprot ID | Q9NYJ8 |
Uniprot Id
Q9NYJ8
Target Species
Human
Target Name
TAB2
Target Full Name
TGF-beta-activated kinase 1 and MAP3K7-binding protein 2
Target Function
Adapter required to activate the JNK and NF-kappa-B signaling pathways through the specific recognition of 'Lys-63'-linked polyubiquitin chains by its RanBP2-type zinc finger (NZF). Acts as an adapter linking MAP3K7/TAK1 and TRAF6 to 'Lys-63'-linked polyubiquitin chains. The RanBP2-type zinc finger (NZF) specifically recognizes Lys-63'-linked polyubiquitin chains unanchored or anchored to the substrate proteins such as RIPK1/RIP1: this acts as a scaffold to organize a large signaling complex to promote autophosphorylation of MAP3K7/TAK1, and subsequent activation of I-kappa-B-kinase (IKK) core complex by MAP3K7/TAK1. Regulates the IL1-mediated translocation of NCOR1 out of the nucleus. Involved in heart development.
Target Involvement
Congenital heart defects, multiple types, 2 (CHTD2)
Target Subcellular Location
Membrane; Peripheral membrane protein. Cytoplasm, cytosol.
Target Tissue Specificity
Widely expressed. In the embryo, expressed in the ventricular trabeculae, endothelial cells of the conotruncal cushions of the outflow tract and in the endothelial cells lining the developing aortic valves.
Target Research Area
Immunology
Target Synonyms
CHTD2; FLJ21885; KIAA0733; MAP3K7IP2; Mitogen activated protein kinase kinase kinase 7 interacting protein 2; Mitogen-activated protein kinase kinase kinase 7-interacting protein 2; OTTHUMP00000040125; TAB 2; TAB-2; Tab2; TAB2_HUMAN; TAK1 binding protein 2; TAK1-binding protein 2; TGF beta activated kinase 1/MAP3K7 binding protein 2; TGF-beta-activated kinase 1 and MAP3K7-binding protein 2; TGF-beta-activated kinase 1-binding protein 2
Target Background
The protein encoded by this gene is an activator of MAP3K7/TAK1, which is required for for the IL-1 induced activation of nuclear factor kappaB and MAPK8/JNK. This protein forms a kinase complex with TRAF6, MAP3K7 and TAB1, and it thus serves as an adaptor that links MAP3K7 and TRAF6. This protein, along with TAB1 and MAP3K7, also participates in the signal transduction induced by TNFSF11/RANKl through the activation of the receptor activator of NF-kappaB (TNFRSF11A/RANK), which may regulate the development and function of osteoclasts. Studies of the related mouse protein indicate that it functions to protect against liver damage caused by chemical stressors. Mutations in this gene cause congenital heart defects, multiple types, 2 (CHTD2). Alternative splicing results in multiple transcript variants.
Notification