-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TADA3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 270-369 of human TADA3 (NP_597814.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against TADA3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 270-369 of human TADA3 (NP_597814.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-09519A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TADA3 |
| Target Synonyms | ADA3; NGG1; hADA3; STAF54; TADA3L; TADA3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, BxPC-3, HepG2, HT-29, Mouse liver, Mouse testis, Rat liver, Rat testis | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 270-369 of human TADA3 (NP_597814.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EENIISPMEDSPIPDMSGKESGADGASTSPRNQNKPFSVPHTKSLESRIKEELIAQGLLESEDRPAEDSEDEVLAELRKRQAELKALSAHNRTKKHDLLR | Uniprot ID | O75528 |
Uniprot Id
O75528
Target Species
Human
Target Name
TADA3
Target Full Name
Transcriptional adapter 3
Target Function
Functions as a component of the PCAF complex. The PCAF complex is capable of efficiently acetylating histones in a nucleosomal context. The PCAF complex could be considered as the human version of the yeast SAGA complex. Also known as a coactivator for p53/TP53-dependent transcriptional activation. Component of the ATAC complex, a complex with histone acetyltransferase activity on histones H3 and H4.
Target Subcellular Location
Nucleus.
Target Protein Families
NGG1 family
Target Tissue Specificity
Ubiquitously expressed.
Target Research Area
Transcription
Target Synonyms
TADA3; ADA3; TADA3L; Transcriptional adapter 3; ADA3 homolog; hADA3; STAF54; Transcriptional adapter 3-like; ADA3-like protein
Target Background
DNA-binding transcriptional activator proteins increase the rate of transcription by interacting with the transcriptional machinery bound to the basal promoter in conjunction with adaptor proteins, possibly by acetylation and destabilization of nucleosomes. The protein encoded by this gene is a transcriptional activator adaptor and a component of the histone acetyl transferase (HAT) coactivator complex which plays a crucial role in chromatin modulation and cell cycle progression. Along with the other components of the complex, this protein links transcriptional activators bound to specific promoters, to histone acetylation and the transcriptional machinery. The protein is also involved in the stabilization and activation of the p53 tumor suppressor protein that plays a role in the cellular response to DNA damage. Alternate splicing results in multiple transcript variants of this gene.
Notification