-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TAF15 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 493-592 of human TAF15 (Q92804) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
The antibody against TAF15 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 493-592 of human TAF15 (Q92804) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
| Cat.No | ADA-13450A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TAF15 |
| Target Synonyms | Npl3; RBP56; TAF2N; TAFII68; TAF15 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HT-29, Mouse thymus | Application | ELISA, WB, IF/ICC, IHC-P, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 493-592 of human TAF15 (Q92804). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GYGGDRGGYGGDRGGYGGDRGGYGGDRGGYGGDRSRGGYGGDRGGGSGYGGDRSGGYGGDRSGGGYGGDRGGGYGGDRGGYGGKMGGRNDYRNDQRNRPY | Uniprot ID | Q92804 |
Uniprot Id
Q92804
Target Species
Human
Target Name
TAF15
Target Full Name
TATA-binding protein-associated factor 2N
Target Function
RNA and ssDNA-binding protein that may play specific roles during transcription initiation at distinct promoters. Can enter the preinitiation complex together with the RNA polymerase II (Pol II).
Target Involvement
A chromosomal aberration involving TAF15/TAF2N is found in a form of extraskeletal myxoid chondrosarcomas (EMC). Translocation t(9;17)(q22;q11) with NR4A3.
Target Subcellular Location
Nucleus. Cytoplasm. Note=Shuttles from the nucleus to the cytoplasm.
Target Protein Families
RRM TET family
Target Tissue Specificity
Ubiquitous. Observed in all fetal and adult tissues.
Target Synonyms
68 kDa TATA-binding protein-associated factor; Npl3; RBP56; RBP56_HUMAN; RNA binding protein 56; RNA-binding protein 56; TAF; TAF(II)68; TAF15; TAF15 RNA polymerase II TATA box binding protein (TBP) associated factor 68kDa; TAF2N; TAFII68; TATA-binding protein-associated factor 2N
Target Background
This gene encodes a member of the TET family of RNA-binding proteins. The encoded protein plays a role in RNA polymerase II gene transcription as a component of a distinct subset of multi-subunit transcription initiation factor TFIID complexes. Translocations involving this gene play a role in acute leukemia and extraskeletal myxoid chondrosarcoma, and mutations in this gene may play a role in amyotrophic lateral sclerosis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Notification