-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TAOK2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 610-730 of human TAOK2 (NP_057235.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TAOK2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 610-730 of human TAOK2 (NP_057235.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04689A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TAOK2 |
| Target Synonyms | PSK; PSK1; TAO1; TAO2; MAP3K17; Tao2beta; PSK1-BETA; TAOK2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, MCF7 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 610-730 of human TAOK2 (NP_057235.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AEWLLRQKEQLQQCQAEEEAGLLRRQRQYFELQCRQYKRKMLLARHSLDQDLLREDLNKKQTQKDLECALLLRQHEATRELELRQLQAVQRTRAELTRLQHQTELGNQLEYNKRREQELRQ | Uniprot ID | Q9UL54 |
Uniprot Id
Q9UL54
Target Species
Human
Target Name
TAOK2
Target Full Name
Serine/threonine-protein kinase TAO2
Target Function
Serine/threonine-protein kinase involved in different processes such as membrane blebbing and apoptotic bodies formation DNA damage response and MAPK14/p38 MAPK stress-activated MAPK cascade. Phosphorylates itself, MBP, activated MAPK8, MAP2K3, MAP2K6 and tubulins. Activates the MAPK14/p38 MAPK signaling pathway through the specific activation and phosphorylation of the upstream MAP2K3 and MAP2K6 kinases. In response to DNA damage, involved in the G2/M transition DNA damage checkpoint by activating the p38/MAPK14 stress-activated MAPK cascade, probably by mediating phosphorylation of upstream MAP2K3 and MAP2K6 kinases. Isoform 1, but not isoform 2, plays a role in apoptotic morphological changes, including cell contraction, membrane blebbing and apoptotic bodies formation. This function, which requires the activation of MAPK8/JNK and nuclear localization of C-terminally truncated isoform 1, may be linked to the mitochondrial CASP9-associated death pathway. Isoform 1 binds to microtubules and affects their organization and stability independently of its kinase activity. Prevents MAP3K7-mediated activation of CHUK, and thus NF-kappa-B activation, but not that of MAPK8/JNK. May play a role in the osmotic stress-MAPK8 pathway. Isoform 2, but not isoform 1, is required for PCDH8 endocytosis. Following homophilic interactions between PCDH8 extracellular domains, isoform 2 phosphorylates and activates MAPK14/p38 MAPK which in turn phosphorylates isoform 2. This process leads to PCDH8 endocytosis and CDH2 cointernalization. Both isoforms are involved in MAPK14 phosphorylation.
Target Subcellular Location
Cytoplasmic vesicle membrane; Multi-pass membrane protein. Cytoplasm, cytoskeleton. Nucleus.
Target Protein Families
Protein kinase superfamily, STE Ser/Thr protein kinase family, STE20 subfamily
Target Tissue Specificity
Ubiquitously expressed, with a higher level of expression in testis and brain.
Target Synonyms
1110033K02Rik; B230344N16; hKFC C; hKFC-C; KIAA0881; Kinase from chicken homolog C; MAP3K17; mKIAA0881; Prostate derived STE20 like kinase 1; Prostate derived STE20 like kinase PSK; Prostate derived sterile 20 like kinase 1; Prostate-derived STE20-like kinase 1; PSK 1; PSK; PSK-1; PSK1; PSK1 beta; Serine/threonine protein kinase TAO2; Serine/threonine-protein kinase TAO2; TAO 1; TAO 2; TAO kinase 2; TAO1; TAO2; TAOK 2; Taok2; TAOK2_HUMAN; Thousand and one amino acid protein 2; Thousand and one amino acid protein kinase; UNQ2971/PRO7431
Target Background
Enables mitogen-activated protein kinase kinase binding activity; neuropilin binding activity; and protein serine/threonine kinase activity. Involved in several processes, including focal adhesion assembly; intracellular signal transduction; and positive regulation of JNK cascade. Located in cytoplasmic vesicle; cytosol; and nuclear lumen. Part of receptor complex.
Notification