-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TBX2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 604-712 of human TBX2 (NP_005985.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TBX2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 604-712 of human TBX2 (NP_005985.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09018A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TBX2 |
| Target Synonyms | VETD; TBX2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | MCF7, Mouse ovary, Rat lung, SH-SY5Y, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 604-712 of human TBX2 (NP_005985.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GSLSRSPFLGSARPRLRFSPYQIPVTIPPSTSLLTTGLASEGSKAAGGNSREPSPLPELALRKVGAPSRGALSPSGSAKEAANELQSIQRLVSGLESQRALSPGRESPK | Uniprot ID | Q13207 |
Uniprot Id
Q13207
Target Species
Human
Target Name
TBX2
Target Full Name
T-box transcription factor TBX2
Target Function
Transcription factor which acts as a transcriptional repressor. May also function as a transcriptional activator. Binds to the palindromic T site 5'-TTCACACCTAGGTGTGAA-3' DNA sequence, or a half-site, which are present in the regulatory region of several genes. Required for cardiac atrioventricular canal formation. May cooperate with NKX2.5 to negatively modulate expression of NPPA/ANF in the atrioventricular canal. May play a role as a positive regulator of TGFB2 expression, perhaps acting in concert with GATA4 in the developing outflow tract myocardium. Plays a role in limb pattern formation. Acts as a transcriptional repressor of ADAM10 gene expression, perhaps in concert with histone deacetylase HDAC1 as cofactor. Involved in branching morphogenesis in both developing lungs and adult mammary glands, via negative modulation of target genes; acting redundantly with TBX3. Required, together with TBX3, to maintain cell proliferation in the embryonic lung mesenchyme; perhaps acting downstream of SHH, BMP and TGFbeta signaling. Involved in modulating early inner ear development, acting independently of, and also redundantly with TBX3, in different subregions of the developing ear. Acts as a negative regulator of PML function in cellular senescence. Acts as a negative regulator of expression of CDKN1A/p21, IL33 and CCN4; repression of CDKN1A is enhanced in response to UV-induced stress, perhaps as a result of phosphorylation by p38 MAPK. Negatively modulates expression of CDKN2A/p14ARF and CDH1/E-cadherin. Plays a role in induction of the epithelial-mesenchymal transition (EMT). Plays a role in melanocyte proliferation, perhaps via regulation of cyclin CCND1. Involved in melanogenesis, acting via negative modulation of expression of DHICA oxidase/TYRP1 and P protein/OCA2. Involved in regulating retinal pigment epithelium (RPE) cell proliferation, perhaps via negatively modulating transcription of the transcription factor CEBPD.
Target Subcellular Location
Nucleus.
Target Tissue Specificity
Expressed primarily in adult in kidney, lung, and placenta. Weak expression in heart and ovary.
Target Synonyms
FLJ10169; HGNC:11597; T box 2; T box transcription factor TBX2; T-box protein 2; T-box transcription factor TBX2; TBX2; TBX2_HUMAN
Target Background
This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This gene product is the human homolog of mouse Tbx2, and shares strong sequence similarity with Drosophila omb protein. Expression studies indicate that this gene may have a potential role in tumorigenesis as an immortalizing agent. Transcript heterogeneity due to alternative polyadenylation has been noted for this gene.
Notification