-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Tbx3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 644-743 of human Tbx3 (O15119) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Tbx3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 644-743 of human Tbx3 (O15119) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-15857A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TBX3 |
| Target Synonyms | UMS; XHL; TBX3-ISO; TBX3 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung, Rat liver | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 644-743 of human Tbx3 (O15119). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SIPVPVPDGSSLLTTALPSMAAAAGPLDGKVAALAASPASVAVDSGSELNSRSSTLSSSSMSLSPKLCAEKEAATSELQSIQRLVSGLEAKPDRSRSASP | Uniprot ID | O15119 |
Uniprot Id
O15119
Target Species
Human
Target Name
TBX3
Target Full Name
T-box transcription factor TBX3
Target Function
Transcriptional repressor involved in developmental processes. Binds to the palindromic T site 5'-TTCACACCTAGGTGTGAA-3' DNA sequence, or a half-site, which are present in the regulatory region of several genes. Probably plays a role in limb pattern formation. Required for mammary placode induction, and maintenance of the mammary buds during development. Involved in branching morphogenesis in both developing lungs and adult mammary glands, via negative modulation of target genes; acting redundantly with TBX2. Required, together with TBX2, to maintain cell proliferation in the embryonic lung mesenchyme; perhaps acting downstream of SHH, BMP and TGFbeta signaling. Involved in modulating early inner ear development, acting independently of, and also redundantly with, TBX2 in different subregions of the developing ear. Acts as a negative regulator of PML function in cellular senescence.
Target Involvement
Ulnar-mammary syndrome (UMS)
Target Subcellular Location
Nucleus.
Target Tissue Specificity
Widely expressed.
Target Synonyms
Bladder cancer related protein XHL; T box 3; T-box protein 3; T-box transcription factor TBX3; Tbx3; TBX3 ISO; TBX3_HUMAN; UMS; XHL
Target Background
This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This protein is a transcriptional repressor and is thought to play a role in the anterior/posterior axis of the tetrapod forelimb. Mutations in this gene cause ulnar-mammary syndrome, affecting limb, apocrine gland, tooth, hair, and genital development. Alternative splicing of this gene results in three transcript variants encoding different isoforms; however, the full length nature of one variant has not been determined.
Notification