-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TC10/RHOQ was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 100-205 of human TC10/RHOQ (P17081) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against TC10/RHOQ was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 100-205 of human TC10/RHOQ (P17081) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14275A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TC10/RHOQ |
| Target Synonyms | ARHQ; TC10; TC10A; RASL7A; HEL-S-42; TC10/RHOQ | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat heart, 22Rv1, 293T, A549 | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 100-205 of human TC10/RHOQ (P17081). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KEEWVPELKEYAPNVPFLLIGTQIDLRDDPKTLARLNDMKEKPICVEQGQKLAKEIGACCYVECSALTQKGLKTVFDEAIIAILTPKKHTVKKRIGSRCINCCLIT | Uniprot ID | P17081 |
Uniprot Id
P17081
Target Species
Human
Target Name
RHOQ
Target Full Name
Rho-related GTP-binding protein RhoQ
Target Function
Plasma membrane-associated small GTPase which cycles between an active GTP-bound and an inactive GDP-bound state. In active state binds to a variety of effector proteins to regulate cellular responses. Involved in epithelial cell polarization processes. May play a role in CFTR trafficking to the plasma membrane. Causes the formation of thin, actin-rich surface projections called filopodia.
Target Subcellular Location
Cytoplasm. Cell membrane; Lipid-anchor.
Target Protein Families
Small GTPase superfamily, Rho family
Target Synonyms
ARHQ; Ras homolog gene family member Q; RAS like family 7 member A; Ras like protein family member 7A ; Ras like protein TC10; Ras related GTP binding protein TC10 ; Ras-like protein family member 7A; Ras-like protein TC10; RASL7A; Rho related GTP binding protein RhoQ; Rho-related GTP-binding protein RhoQ; Rhoq; RHOQ_HUMAN; TC10A
Target Background
This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. The encoded protein is an important signalling protein for sarcomere assembly and has been shown to play a significant role in the exocytosis of the solute carrier family 2, facilitated glucose transporter member 4 and other proteins, possibly acting as the signal that turns on the membrane fusion machinery. Three related pseudogene have been identified on chromosomes 2 and 14.
Notification