-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TCF4/TCF7L2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 124-188 of human TCF4/TCF7L2 (NP_001354872.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TCF4/TCF7L2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 124-188 of human TCF4/TCF7L2 (NP_001354872.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10617A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TCF4/TCF7L2 |
| Target Synonyms | TCF4; TCF-4; TCF4/TCF7L2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain, SW620 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 124-188 of human TCF4/TCF7L2 (NP_001354872.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TARTLHFQSGSTHYSAYKTIEHQIAVQYLQMKWPLLDVQAGSLQSRQALKDARSPSPAHIVSNKV | Uniprot ID | Q9NQB0 |
Uniprot Id
Q9NQB0
Target Species
Human
Target Name
TCF7L2
Target Full Name
Transcription factor 7-like 2
Target Function
Participates in the Wnt signaling pathway and modulates MYC expression by binding to its promoter in a sequence-specific manner. Acts as repressor in the absence of CTNNB1, and as activator in its presence. Activates transcription from promoters with several copies of the Tcf motif 5'-CCTTTGATC-3' in the presence of CTNNB1. TLE1, TLE2, TLE3 and TLE4 repress transactivation mediated by TCF7L2/TCF4 and CTNNB1. Expression of dominant-negative mutants results in cell-cycle arrest in G1. Necessary for the maintenance of the epithelial stem-cell compartment of the small intestine.
Target Involvement
Diabetes mellitus, non-insulin-dependent (NIDDM)
Target Subcellular Location
Nucleus, PML body. Note=Diffuse pattern. Colocalizes with SUMO1 and PIAS4 in a subset of PML (promyelocytic leukemia) nuclear bodies.
Target Protein Families
TCF/LEF family
Target Tissue Specificity
Detected in epithelium from small intestine, with the highest expression at the top of the crypts and a gradient of expression from crypt to villus. Detected in colon epithelium and colon cancer, and in epithelium from mammary gland and carcinomas derived
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
HMG box transcription factor 4; hTCF 4; hTCF-4; T cell factor 4; T cell specific HMG box; T cell specific transcription factor 4; T-cell factor 4; T-cell-specific transcription factor 4; TCF 4; TCF-4; TCF4; TCF7L2; TCF7L2 protein; TF7L2_HUMAN; Transcription factor 7 like 2; Transcription factor 7 like 2 T cell specific HMG box; Transcription factor 7-like 2
Target Background
This gene encodes a high mobility group (HMG) box-containing transcription factor that plays a key role in the Wnt signaling pathway. The protein has been implicated in blood glucose homeostasis. Genetic variants of this gene are associated with increased risk of type 2 diabetes. Several transcript variants encoding multiple different isoforms have been found for this gene.
Notification