-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TCF7L1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 260-340 of human TCF7L1 (NP_112573.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TCF7L1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 260-340 of human TCF7L1 (NP_112573.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07203A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TCF7L1 |
| Target Synonyms | TCF3; TCF-3; TCF7L1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-431, A-549, HCT116, Mouse brain, Mouse lung, Mouse skin, Rat lung, Rat skin | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 260-340 of human TCF7L1 (NP_112573.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YSLPPGGFRHPYPALAMNASMSSLVSSRFSPHMVAPAHPGLPTSGIPHPAIVSPIVKQEPAPPSLSPAVSVKSPVTVKKEE | Uniprot ID | Q9HCS4 |
Uniprot Id
Q9HCS4
Target Species
Human
Target Name
TCF7L1
Target Full Name
Transcription factor 7-like 1
Target Function
Participates in the Wnt signaling pathway. Binds to DNA and acts as a repressor in the absence of CTNNB1, and as an activator in its presence. Necessary for the terminal differentiation of epidermal cells, the formation of keratohyalin granules and the development of the barrier function of the epidermis. Down-regulates NQO1, leading to increased mitomycin c resistance.
Target Subcellular Location
Nucleus.
Target Protein Families
TCF/LEF family
Target Tissue Specificity
Detected in hair follicles and skin keratinocytes, and at lower levels in stomach epithelium.
Target Synonyms
bHLHb21; HMG box transcription factor 3; HMG box transcription factor; OTTMUSP00000023419; T cell factor 3; TCF 3; TCF-3; TCF3; Tcf7l1; TF7L1_HUMAN; Transcription factor 7 like 1 (T-cell specific, HMG-box); Transcription factor 7 like 1; Transcription factor 7-like 1
Target Background
This gene encodes a member of the T cell factor/lymphoid enhancer factor family of transcription factors. These transcription factors are activated by beta catenin, mediate the Wnt signaling pathway and are antagonized by the transforming growth factor beta signaling pathway. The encoded protein contains a high mobility group-box DNA binding domain and participates in the regulation of cell cycle genes and cellular senescence.
Notification