-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TDP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human TDP1 (NP_060789.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against TDP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human TDP1 (NP_060789.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-03889A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TDP1 |
| Target Synonyms | TDP1 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | DU145, HL-60, Rat thymus | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human TDP1 (NP_060789.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSQEGDYGRWTISSSDESEEEKPKPDKPSTSSLLCARQGAANEPRYTCSEAQKAAHKRKISPVKFSNTDSVLPPKRQKSGSQEDLGWCLSSSDDELQPEMPQKQAEKVVIKKEKDISAPNDGTAQRTENHGAPACHRLKE | Uniprot ID | Q9NUW8 |
Uniprot Id
Q9NUW8
Target Species
Human
Target Name
TDP1
Target Full Name
Tyrosyl-DNA phosphodiesterase 1
Target Function
DNA repair enzyme that can remove a variety of covalent adducts from DNA through hydrolysis of a 3'-phosphodiester bond, giving rise to DNA with a free 3' phosphate. Catalyzes the hydrolysis of dead-end complexes between DNA and the topoisomerase I active site tyrosine residue. Hydrolyzes 3'-phosphoglycolates on protruding 3' ends on DNA double-strand breaks due to DNA damage by radiation and free radicals. Acts on blunt-ended double-strand DNA breaks and on single-stranded DNA. Has low 3'exonuclease activity and can remove a single nucleoside from the 3'end of DNA and RNA molecules with 3'hydroxyl groups. Has no exonuclease activity towards DNA or RNA with a 3'phosphate.
Target Involvement
Spinocerebellar ataxia, autosomal recessive, with axonal neuropathy (SCAN1)
Target Subcellular Location
Nucleus. Cytoplasm.
Target Protein Families
Tyrosyl-DNA phosphodiesterase family
Target Tissue Specificity
Ubiquitously expressed. Similar expression throughout the central nervous system (whole brain, amygdala, caudate nucleus, cerebellum, cerebral cortex, frontal lobe, hippocampus, medulla oblongata, occipital lobe, putamen, substantia nigra, temporal lobe,
Target Synonyms
AI838772; AW493413; FLJ11090; MGC104252; MGC112732; RP24-311F12.2; SCAN1; TDP1; TYDP; TYDP1_HUMAN; Tyr-DNA phosphodiesterase 1; Tyrosyl-DNA phosphodiesterase 1
Target Background
The protein encoded by this gene is involved in repairing stalled topoisomerase I-DNA complexes by catalyzing the hydrolysis of the phosphodiester bond between the tyrosine residue of topoisomerase I and the 3-prime phosphate of DNA. This protein may also remove glycolate from single-stranded DNA containing 3-prime phosphoglycolate, suggesting a role in repair of free-radical mediated DNA double-strand breaks. This gene is a member of the phospholipase D family and contains two PLD phosphodiesterase domains. Mutations in this gene are associated with the disease spinocerebellar ataxia with axonal neuropathy (SCAN1).
Notification