Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TFAP4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-338 of human TFAP4 (NP_003214.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against TFAP4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-338 of human TFAP4 (NP_003214.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-15927A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TFAP4 |
| Target Synonyms | AP-4; bHLHc41; P4 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 22Rv1, HT-29, SGC-7901 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-338 of human TFAP4 (NP_003214.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QQEQVRLLHQEKLEREQQQLRTQLLPPPAPTHHPTVIVPAPPPPPSHHINVVTMGPSSVINSVSTSRQNLDTIVQAIQHIEGTQEKQELEEEQRRAVIVKPVRSCPEAPTSDTASDSEASDSDAMDQSREEPSGDGELP | Uniprot ID | Q01664 |
Uniprot Id
Q01664
Target Species
Human
Target Name
TFAP4
Target Full Name
Transcription factor AP-4
Target Function
Transcription factor that activates both viral and cellular genes by binding to the symmetrical DNA sequence 5'-CAGCTG-3'.
Target Subcellular Location
Nucleus.
Target Synonyms
AP-4; bHLHc41; P4
Target Background
Transcription factors of the basic helix-loop-helix-zipper (bHLH-ZIP) family contain a basic domain, which is used for DNA binding, and HLH and ZIP domains, which are used for oligomerization. Transcription factor AP4 activates both viral and cellular genes by binding to the symmetrical DNA sequence CAGCTG (Mermod et al., 1988 [PubMed 2833704]; Hu et al., 1990 [PubMed 2123466]).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
