-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TGF beta Receptor II (TGFBR2) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 23-130 of human TGF beta Receptor II (TGFBR2) (TGFBR2) (P37173) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TGF beta Receptor II (TGFBR2) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 23-130 of human TGF beta Receptor II (TGFBR2) (TGFBR2) (P37173) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-15978A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TGF beta Receptor II (TGFBR2) |
| Target Synonyms | AAT3; FAA3; LDS2; MFS2; RIIC; LDS1B; LDS2B; TAAD2; TBRII; TBR-ii; TGFR-2; tbetaR-II; TGFbeta-RII; TGF beta Receptor II (TGFBR2) | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Hep G2 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 23-130 of human TGF beta Receptor II (TGFBR2) (TGFBR2) (P37173). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPG | Uniprot ID | P37173 |
Uniprot Id
P37173
Target Species
Human
Target Name
TGFBR2
Target Full Name
TGF-beta receptor type-2
Target Function
Transmembrane serine/threonine kinase forming with the TGF-beta type I serine/threonine kinase receptor, TGFBR1, the non-promiscuous receptor for the TGF-beta cytokines TGFB1, TGFB2 and TGFB3. Transduces the TGFB1, TGFB2 and TGFB3 signal from the cell surface to the cytoplasm and is thus regulating a plethora of physiological and pathological processes including cell cycle arrest in epithelial and hematopoietic cells, control of mesenchymal cell proliferation and differentiation, wound healing, extracellular matrix production, immunosuppression and carcinogenesis. The formation of the receptor complex composed of 2 TGFBR1 and 2 TGFBR2 molecules symmetrically bound to the cytokine dimer results in the phosphorylation and the activation of TGFRB1 by the constitutively active TGFBR2. Activated TGFBR1 phosphorylates SMAD2 which dissociates from the receptor and interacts with SMAD4. The SMAD2-SMAD4 complex is subsequently translocated to the nucleus where it modulates the transcription of the TGF-beta-regulated genes. This constitutes the canonical SMAD-dependent TGF-beta signaling cascade. Also involved in non-canonical, SMAD-independent TGF-beta signaling pathways.
Target Involvement
Hereditary non-polyposis colorectal cancer 6 (HNPCC6); Esophageal cancer (ESCR); Loeys-Dietz syndrome 2 (LDS2)
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein. Membrane raft.
Target Protein Families
Protein kinase superfamily, TKL Ser/Thr protein kinase family, TGFB receptor subfamily
Target Research Area
Signal Transduction
Target Synonyms
TGFBR2; TGF-beta receptor type-2; TGFR-2; TGF-beta type II receptor; Transforming growth factor-beta receptor type II; TGF-beta receptor type II; TbetaR-II
Target Background
The protein encoded by this gene is a transmembrane protein that has a protein kinase domain, forms a heterodimeric complex with TGF-beta receptor type-1, and binds TGF-beta. This receptor/ligand complex phosphorylates proteins, which then enter the nucleus and regulate the transcription of genes related to cell proliferation, cell cycle arrest, wound healing, immunosuppression, and tumorigenesis. Mutations in this gene have been associated with Marfan Syndrome, Loeys-Deitz Aortic Aneurysm Syndrome, and the development of various types of tumors. Alternatively spliced transcript variants encoding different isoforms have been characterized.
Notification