-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TGM1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 100-280 of human TGM1 (NP_000350.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TGM1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 100-280 of human TGM1 (NP_000350.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06290A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TGM1 |
| Target Synonyms | LI; KTG; LI1; TGK; ICR2; ARCI1; TGASE; TGM1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, Rat spleen | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 100-280 of human TGM1 (NP_000350.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AGDGTIREGMLVVNGVDLLSSRSDQNRREHHTDEYEYDELIVRRGQPFHMLLLLSRTYESSDRITLELLIGNNPEVGKGTHVIIPVGKGGSGGWKAQVVKASGQNLNLRVHTSPNAIIGKFQFTVRTQSDAGEFQLPFDPRNEIYILFNPWCPEDIVYVDHEDWRQEYVLNESGRIYYGTE | Uniprot ID | P22735 |
Uniprot Id
P22735
Target Species
Human
Target Name
TGM1
Target Full Name
Protein-glutamine gamma-glutamyltransferase K
Target Function
Catalyzes the cross-linking of proteins and the conjugation of polyamines to proteins. Responsible for cross-linking epidermal proteins during formation of the stratum corneum. Involved in cell proliferation.
Target Involvement
Ichthyosis, congenital, autosomal recessive 1 (ARCI1)
Target Subcellular Location
Membrane; Lipid-anchor.
Target Protein Families
Transglutaminase superfamily, Transglutaminase family
Target Synonyms
ARCI1; Epidermal TGase; ICR2; KTG; LI; LI1; Protein glutamine gamma glutamyltransferase K; Protein-glutamine gamma-glutamyltransferase K; TG(K); TGase 1; TGASE; TGase K; TGase-1; TGK; TGM1; TGM1_HUMAN; Transglutaminase 1 (K polypeptide epidermal type I; protein glutamine gamma glutamyltransferase); Transglutaminase 1; Transglutaminase K; Transglutaminase; keratinocyte; Transglutaminase-1
Target Background
The protein encoded by this gene is a membrane protein that catalyzes the addition of an alkyl group from an akylamine to a glutamine residue of a protein, forming an alkylglutamine in the protein. This protein alkylation leads to crosslinking of proteins and catenation of polyamines to proteins. This gene contains either one or two copies of a 22 nt repeat unit in its 3' UTR. Mutations in this gene have been associated with autosomal recessive lamellar ichthyosis (LI) and nonbullous congenital ichthyosiform erythroderma (NCIE).
Notification