-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against THRSP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-146 of human THRSP (NP_003242.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against THRSP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-146 of human THRSP (NP_003242.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-02614A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | THRSP |
| Target Synonyms | S14; Lpgp; THRP; LPGP1; SPOT14; THRSP | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-146 of human THRSP (NP_003242.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MQVLTKRYPKNCLLTVMDRYAAEVHNMEQVVMIPSLLRDVQLSGPGGQAQAEAPDLYTYFTMLKAICVDVDHGLLPREEWQAKVAGSEENGTAETEEVEDESASGELDLEAQFHLHFSSLHHILMHLTEKAQEVTRKYQEMTGQVW | Uniprot ID | Q92748 |
Uniprot Id
Q92748
Target Species
Human
Target Name
THRSP
Target Full Name
Thyroid hormone-inducible hepatic protein
Target Function
Plays a role in the regulation of lipogenesis, especially in lactating mammary gland. Important for the biosynthesis of triglycerides with medium-length fatty acid chains. May modulate lipogenesis by interacting with MID1IP1 and preventing its interaction with ACACA. May function as transcriptional coactivator. May modulate the transcription factor activity of THRB.
Target Subcellular Location
Nucleus. Cytoplasm.
Target Protein Families
SPOT14 family
Target Tissue Specificity
Mainly expressed in tissues that synthesize triglycerides.
Target Research Area
Signal Transduction
Target Synonyms
Lpgp; LPGP1; MGC21659; OTTHUMP00000233866; S14; S14 protein ; SPOT 14; Spot 14 protein; SPOT14; SPOT14 homolog; Thrsp; THRSP_HUMAN; Thyroid hormone inducible hepatic protein ; Thyroid hormone responsive (SPOT14 homolog rat); Thyroid hormone responsive; Thyroid hormone responsive protein ; Thyroid hormone responsive SPOT14 ; Thyroid hormone-inducible hepatic protein
Target Background
The protein encoded by this gene is similar to the gene product of S14, a rat gene whose expression is limited to liver and adipose tissue and is controlled by nutritional and hormonal factors. This gene has been shown to be expressed in liver and adipocytes, particularly in lipomatous modules. It is also found to be expressed in lipogenic breast cancers, which suggests a role in controlling tumor lipid metabolism.
Notification