Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TIMMDC1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 206-285 of human TIMMDC1 (NP_057673.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against TIMMDC1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 206-285 of human TIMMDC1 (NP_057673.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-00581A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TIMMDC1 |
| Target Synonyms | C3orf1; MC1DN31; TIMMDC1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-375, THP-1, U-937 | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 206-285 of human TIMMDC1 (NP_057673.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LMAFQKYSGETVQERKQKDRKALHELKLEEWKGRLQVTEHLPEKIESSLQEDEPENDAKKIEALLNLPRNPSVIDKQDKD | Uniprot ID | Q9NPL8 |
Uniprot Id
Q9NPL8
Target Species
Human
Target Name
TIMMDC1
Target Full Name
Complex I assembly factor TIMMDC1, mitochondrial
Target Function
Chaperone protein involved in the assembly of the mitochondrial NADH:ubiquinone oxidoreductase complex (complex I). Participates in constructing the membrane arm of complex I.
Target Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.
Target Protein Families
Tim17/Tim22/Tim23 family
Target Tissue Specificity
Generalized expression enhanced in heart and skeletal muscle.
Target Synonyms
TIMMDC1; C3orf1; UNQ247/PRO284; Complex I assembly factor TIMMDC1, mitochondrial; Protein M5-14; Translocase of inner mitochondrial membrane domain-containing protein 1; TIMM domain containing-protein 1
Target Background
Located in mitochondrion and nucleoplasm. Implicated in nuclear type mitochondrial complex I deficiency 31.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
