Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TMED3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 24-180 of human TMED3 (NP_031390.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against TMED3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 24-180 of human TMED3 (NP_031390.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-07017A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TMED3 |
| Target Synonyms | p26; P24B; p24g4; C15orf22; p24gamma4; TMED3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-431, A-549, MCF7 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 24-180 of human TMED3 (NP_031390.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PCGAELTFELPDNAKQCFHEEVEQGVKFSLDYQVITGGHYDVDCYVEDPQGNTIYRETKKQYDSFTYRAEVKGVYQFCFSNEFSTFSHKTVYFDFQVGDEPPILPDMGNRVTALTQMESACVTIHEALKTVIDSQTHYRLREAQDRARAEDLNSRVS | Uniprot ID | Q9Y3Q3 |
Uniprot Id
Q9Y3Q3
Target Species
Human
Target Name
TMED3
Target Full Name
Transmembrane emp24 domain-containing protein 3
Target Function
Potential role in vesicular protein trafficking, mainly in the early secretory pathway. Contributes to the coupled localization of TMED2 and TMED10 in the cis-Golgi network.
Target Subcellular Location
Endoplasmic reticulum-Golgi intermediate compartment membrane; Single-pass type I membrane protein. Golgi apparatus, cis-Golgi network membrane; Single-pass type I membrane protein. Golgi apparatus, Golgi stack membrane; Single-pass type I membrane protein. Endoplasmic reticulum membrane; Single-pass type I membrane protein. Cytoplasmic vesicle, COPI-coated vesicle membrane; Single-pass type I membrane protein.
Target Protein Families
EMP24/GP25L family
Target Synonyms
C15orf22; Integral type I protein; Membrane protein p24B; p24 family protein gamma 4; p24 family protein gamma-4; P24B; p24g4; p24gamma4; p26; Testis tissue sperm binding protein Li 48e; Tmed3; TMED3_HUMAN; Transmembrane emp24 domain containing protein 3; Transmembrane emp24 domain-containing protein 3; Transmembrane p24 trafficking protein 3; UNQ5357/PRO1078
Target Background
Predicted to be involved in Golgi organization; endoplasmic reticulum to Golgi vesicle-mediated transport; and intracellular protein transport. Located in Golgi apparatus; endoplasmic reticulum; and endoplasmic reticulum-Golgi intermediate compartment.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
