-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TMEFF2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 275-374 of human TMEFF2 (Q9UIK5) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against TMEFF2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 275-374 of human TMEFF2 (Q9UIK5) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14318A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TMEFF2 |
| Target Synonyms | TR; HPP1; TPEF; TR-2; TENB2; CT120.2; TMEFF2 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, PC-3, Rat testis, SH-SY5Y | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 275-374 of human TMEFF2 (Q9UIK5). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HGKCEHSINMQEPSCRCDAGYTGQHCEKKDYSVLYVVPGPVRFQYVLIAAVIGTIQIAVICVVVLCITRKCPRSNRIHRQKQNTGHYSSDNTTRASTRLI | Uniprot ID | Q9UIK5 |
Uniprot Id
Q9UIK5
Target Species
Human
Target Name
TMEFF2
Target Full Name
Tomoregulin-2
Target Function
May be a survival factor for hippocampal and mesencephalic neurons. The shedded form up-regulates cancer cell proliferation, probably by promoting ERK1/2 phosphorylation.
Target Subcellular Location
[Isoform 1]: Membrane; Single-pass type I membrane protein.; [Isoform 2]: Membrane; Single-pass type I membrane protein.; [Isoform 3]: Secreted.
Target Protein Families
Tomoregulin family
Target Tissue Specificity
Highly expressed in adult and fetal brain, spinal cord and prostate. Expressed in all brain regions except the pituitary gland, with highest levels in amygdala and corpus callosum. Expressed in the pericryptal myofibroblasts and other stromal cells of nor
Target Synonyms
Cancer/testis antigen family 120 member 2; CT120.2; HPP 1; HPP1; Hyperplastic polyposis protein 1; TEFF 2; TEFF2; TEFF2_HUMAN; TENB 2; TENB2; TMEFF2; Tomoregulin; Tomoregulin-2; TPEF; TR 2; TR; TR-2; Transmembrane protein containing epidermal growth factor and follistatin domains; Transmembrane protein TENB2; Transmembrane protein with EGF like and two follistatin like domains 2; Transmembrane protein with EGF-like and two follistatin-like domains
Target Background
This gene encodes a member of the tomoregulin family of transmembrane proteins. This protein has been shown to function as both an oncogene and a tumor suppressor depending on the cellular context and may regulate prostate cancer cell invasion. Multiple soluble forms of this protein have been identified that arise from both an alternative splice variant and ectodomain shedding. Additionally, this gene has been found to be hypermethylated in multiple cancer types. Alternative splicing results in multiple transcript variants.
Notification