Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TMEM106B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 148-274 of human TMEM106B (NP_060844.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TMEM106B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 148-274 of human TMEM106B (NP_060844.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10592A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TMEM106B |
| Target Synonyms | HLD16; TMEM106B | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, Mouse liver, U-251MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 148-274 of human TMEM106B (NP_060844.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NTLNITNNNYYSVEVENITAQVQFSKTVIGKARLNNITIIGPLDMKQIDYTVPTVIAEEMSYMYDFCTLISIKVHNIVLMMQVTVTTTYFGHSEQISQERYQYVDCGRNTTYQLGQSEYLNVLQPQQ | Uniprot ID | Q9NUM4 |
Uniprot Id
Q9NUM4
Target Species
Human
Target Name
TMEM106B
Target Full Name
Transmembrane protein 106B
Target Function
Involved in dendrite morphogenesis and maintenance by regulating lysosomal trafficking via its interaction with MAP6. May act by inhibiting retrograde transport of lysosomes along dendrites. Required for dendrite branching.
Target Involvement
Ubiquitin-positive frontotemporal dementia (UP-FTD); Frontotemporal dementia and/or amyotrophic lateral sclerosis 1 (FTDALS1)
Target Subcellular Location
Late endosome membrane; Single-pass type II membrane protein. Lysosome membrane; Single-pass type II membrane protein. Membrane; Lipid-anchor.
Target Protein Families
TMEM106 family
Target Tissue Specificity
Expressed in frontal cortex.
Target Synonyms
2310036D22Rik; 5830455K21Rik; 6430519M21Rik; AI428776; AI661344; FLJ11273; LRRGT00101; MGC33727; MGC94135; T106B_HUMAN; Tmem106b; Transmembrane protein 106B
Target Background
Enables ATPase binding activity. Involved in dendrite morphogenesis and lysosome localization. Located in endosome and lysosomal membrane. Implicated in hypomyelinating leukodystrophy.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
