Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TMEM11 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human TMEM11 (NP_003867.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against TMEM11 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human TMEM11 (NP_003867.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-10505A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TMEM11 |
| Target Synonyms | PM1; PMI; C17orf35; TMEM11 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human TMEM11 (NP_003867.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAAWGRRRLGPGSSGGSARERVSLSATDCYIVHEIYNGENAQDQFEYELEQALEAQYKYIVIEPTRIGDETARWITVGNC | Uniprot ID | P17152 |
Uniprot Id
P17152
Target Species
Human
Target Name
TMEM11
Target Full Name
Transmembrane protein 11, mitochondrial
Target Function
Plays a role in mitochondrial morphogenesis.
Target Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Target Protein Families
TMEM11 family
Target Synonyms
TMEM11; C17orf35; PM1; Transmembrane protein 11, mitochondrial; Protein PM1; Protein PMI
Target Background
Involved in mitochondrion organization. Located in mitochondrion. Is integral component of mitochondrial inner membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
