Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TMEM18 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 40-100 of human TMEM18 (NP_690047.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TMEM18 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 40-100 of human TMEM18 (NP_690047.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07313A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TMEM18 |
| Target Synonyms | lncND; TMEM18 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-549, Rat kidney | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 40-100 of human TMEM18 (NP_690047.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LLTCLSSRSYRLQIGHFLCLVILVYCAEYINEAAAMNWRLFSKYQYFDSRGMFISIVFSAP | Uniprot ID | Q96B42 |
Uniprot Id
Q96B42
Target Species
Human
Target Name
TMEM18
Target Full Name
Transmembrane protein 18
Target Function
Transcription repressor. Sequence-specific ssDNA and dsDNA binding protein, with preference for GCT end CTG repeats. Cell migration modulator which enhances the glioma-specific migration ability of neural stem cells (NSC) and neural precursor cells (NPC).
Target Subcellular Location
Cytoplasm. Nucleus membrane; Multi-pass membrane protein.
Target Protein Families
TMEM18 family
Target Synonyms
TMEM18; Transmembrane protein 18
Target Background
Predicted to enable DNA binding activity. Involved in cell migration. Located in nuclear membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
