Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TMEM25 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 223-322 of human TMEM25 (NP_001137506.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against TMEM25 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 223-322 of human TMEM25 (NP_001137506.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-05689A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TMEM25 |
| Target Synonyms | TMEM25 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat brain, LO2, Mouse brain, OVCAR3, Rat kidney, U-87MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 223-322 of human TMEM25 (NP_001137506.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | APGPSRHPSLISSDSNNLKLNNVRLPRENMSLPSNLQLNDLTPDSRAVKPADRQMAQNNSRPELLDPEPGGLLTSQGFIRLPVLGYIYRVSSVSSDEIWL | Uniprot ID | Q86YD3 |
Uniprot Id
Q86YD3
Target Species
Human
Target Name
TMEM25
Target Full Name
Transmembrane protein 25
Target Function
In neurons, modulates the degradation of NMDA receptor GRIN2B subunit. Plays a role in the regulation of neuronal excitability.
Target Subcellular Location
[Isoform 1]: Cell membrane; Single-pass type I membrane protein.; [Isoform 4]: Cell membrane; Single-pass type I membrane protein.; [Isoform 2]: Secreted.; [Isoform 3]: Secreted.; Late endosome. Lysosome.
Target Tissue Specificity
Expressed throughout the brain with higher levels in the pyramidal cell layer of the hippocampal CA1 and CA3 regions. Also highly expressed iwhith the hippocampal dentate gyrus region and cerebellum and in scattered neurons in the cerebral cortex.
Target Research Area
Cell Biology
Target Synonyms
0610039J01Rik; FLJ14399; Tmem25; TMM25_HUMAN; Transmembrane protein 25
Target Background
Predicted to be involved in negative regulation of excitatory postsynaptic potential and regulation of protein stability. Predicted to be located in late endosome and lysosome.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
