Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TMF1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 900-1000 of human TMF1 (NP_009045.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TMF1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 900-1000 of human TMF1 (NP_009045.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06935A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TMF1 |
| Target Synonyms | TMF; ARA160; TMF1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | DU145, Raji, U-87MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 900-1000 of human TMF1 (NP_009045.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MKVEQERKKAIFTQETIKEKERKPFSVSSTPTMSRSSSISGVDMAGLQTSFLSQDESHDHSFGPMPISANGSNLYDAVRMGAGSSIIENLQSQLKLREGEI | Uniprot ID | P82094 |
Uniprot Id
P82094
Target Species
Human
Target Name
TMF1
Target Full Name
TATA element modulatory factor
Target Function
Potential coactivator of the androgen receptor. Mediates STAT3 degradation. May play critical roles in two RAB6-dependent retrograde transport processes: one from endosomes to the Golgi and the other from the Golgi to the ER. This protein binds the HIV-1 TATA element and inhibits transcriptional activation by the TATA-binding protein (TBP).
Target Subcellular Location
Cytoplasm. Nucleus. Golgi apparatus membrane. Note=Concentrated at the budding structures localized at the tips of cisternae.
Target Synonyms
Androgen receptor coactivator 160 kDa protein; Androgen receptor-associated protein of 160 kDa; ARA160; TATA element modulatory factor 1; TATA element modulatory factor; TMF; Tmf1; TMF1_HUMAN
Target Background
Enables androgen receptor binding activity and nuclear receptor coactivator activity. Involved in androgen receptor signaling pathway and positive regulation of transcription by RNA polymerase II. Located in Golgi apparatus.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
