Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TMX1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 210-280 of human TMX1 (NP_110382.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against TMX1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 210-280 of human TMX1 (NP_110382.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-05362A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TMX1 |
| Target Synonyms | TMX; TXNDC; PDIA11; TXNDC1; TMX1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, Jurkat, LO2 | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 210-280 of human TMX1 (NP_110382.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KRRRPQPYPYPSKKLLSESAQPLKKVEEEQEADEEDVSEEEAESKEGTNKDFPQNAIRQRSLGPSLATDKS | Uniprot ID | Q9H3N1 |
Uniprot Id
Q9H3N1
Target Species
Human
Target Name
TMX1
Target Full Name
Thioredoxin-related transmembrane protein 1
Target Function
May participate in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyze dithiol-disulfide exchange reactions.
Target Subcellular Location
Membrane; Single-pass type I membrane protein. Endoplasmic reticulum membrane; Single-pass type I membrane protein.
Target Tissue Specificity
Ubiquitous. Highly expressed in kidney, liver, placenta and lung.
Target Synonyms
PDIA11; Protein disulfide isomerase family A, member 11; Thioredoxin domain containing 1; Thioredoxin domain containing; Thioredoxin domain-containing protein 1; Thioredoxin-related transmembrane protein 1; TMX; TMX1; TMX1_HUMAN; Transmembrane Trx-related protein; TXNDC; TXNDC1
Target Background
This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, a catalytically active thioredoxin domain, and one transmembrane domain. Unlike most members of this gene family, it lacks a C-terminal ER-retention sequence. The mature membrane-bound protein can both oxidize and reduce disulfide bonds and acts selectively on membrane-associated polypeptides.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
