-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TNFRSF10D/TRAILR4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 56-211 of human TNFRSF10D/TRAILR4 (NP_003831.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on FC.
The antibody against TNFRSF10D/TRAILR4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 56-211 of human TNFRSF10D/TRAILR4 (NP_003831.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on FC.
| Cat.No | ADA-15626A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TNFRSF10D/TRAILR4 |
| Target Synonyms | DCR2; CD264; TRUNDD; TRAILR4; TRAIL-R4; TNFRSF10D/TRAILR4 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | FC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 56-211 of human TNFRSF10D/TRAILR4 (NP_003831.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ATIPRQDEVPQQTVAPQQQRRSLKEEECPAGSHRSEYTGACNPCTEGVDYTIASNNLPSCLLCTVCKSGQTNKSSCTTTRDTVCQCEKGSFQDKNSPEMCRTCRTGCPRGMVKVSNCTPRSDIKCKNESAASSTGKTPAAEETVTTILGMLASPYH | Uniprot ID | Q9UBN6 |
Uniprot Id
Q9UBN6
Target Species
Human
Target Name
TNFRSF10D
Target Full Name
Tumor necrosis factor receptor superfamily member 10D
Target Function
Receptor for the cytotoxic ligand TRAIL. Contains a truncated death domain and hence is not capable of inducing apoptosis but protects against TRAIL-mediated apoptosis. Reports are contradictory with regards to its ability to induce the NF-kappa-B pathway. According to PubMed:9382840, it cannot but according to PubMed:9430226, it can induce the NF-kappa-B pathway.
Target Subcellular Location
Membrane; Single-pass type I membrane protein.
Target Tissue Specificity
Widely expressed, in particular in fetal kidney, lung and liver, and in adult testis and liver. Also expressed in peripheral blood leukocytes, colon and small intestine, ovary, prostate, thymus, spleen, pancreas, kidney, lung, placenta and heart.
Target Research Area
Cancer, Apoptosis
Target Synonyms
CD 264; CD264; DcR 2; DcR2; Decoy receptor 2; Decoy with truncated death domain; OTTHUMP00000123528; TNF receptor related receptor for TRAIL ; TNF related apoptosis inducing ligand receptor 4; TNF-related apoptosis-inducing ligand receptor 4; TNFRSF 10D; TNFRSF10D; TR10D_HUMAN; TRAIL R4; TRAIL receptor 4; TRAIL receptor with a truncated death domain; TRAIL-R4; TRAILR4; TRUNDD; Tumor necrosis factor receptor superfamily member 10D; Tumor necrosis factor receptor superfamily; member 10d; decoy with truncated death domain
Target Background
The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contains an extracellular TRAIL-binding domain, a transmembrane domain, and a truncated cytoplamic death domain. This receptor does not induce apoptosis, and has been shown to play an inhibitory role in TRAIL-induced cell apoptosis.
Notification