-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TNFRSF11A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 466-616 of human TNFRSF11A (NP_003830.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against TNFRSF11A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 466-616 of human TNFRSF11A (NP_003830.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-12193A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TNFRSF11A |
| Target Synonyms | FEO; OFE; ODFR; OSTS; PDB2; RANK; CD265; OPTB7; TRANCER; LOH18CR1; TRANCE-R; TNFRSF11A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HT-29, LO2, U-87MG | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 466-616 of human TNFRSF11A (NP_003830.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RGPLPQCAYGMGLPPEEEASRTEARDQPEDGADGRLPSSARAGAGSGSSPGGQSPASGNVTGNSNSTFISSGQVMNFKGDIIVVYVSQTSQEGAAAAAEPMGRPVQEETLARRDSFAGNGPRFPDPCGGPEGLREPEKASRPVQEQGGAKA | Uniprot ID | Q9Y6Q6 |
Uniprot Id
Q9Y6Q6
Target Species
Human
Target Name
TNFRSF11A
Target Full Name
Tumor necrosis factor receptor superfamily member 11A
Target Function
Receptor for TNFSF11/RANKL/TRANCE/OPGL; essential for RANKL-mediated osteoclastogenesis. Involved in the regulation of interactions between T-cells and dendritic cells.
Target Involvement
Familial expansile osteolysis (FEO); Paget disease of bone 2, early-onset (PDB2); Osteopetrosis, autosomal recessive 7 (OPTB7)
Target Subcellular Location
[Isoform 1]: Cell membrane; Single-pass type I membrane protein.; [Isoform RANK-e5a]: Cell membrane; Single-pass type I membrane protein.
Target Tissue Specificity
Ubiquitous expression with high levels in skeletal muscle, thymus, liver, colon, small intestine and adrenal gland.
Target Research Area
Immunology
Target Synonyms
CD 265; CD265; FEO; LOH18CR1; Loss of heterozygosity 18 chromosomal region 1; mRANK; ODFR; OFE; OPTB7; Osteoclast differentiation factor receptor; OSTS; Paget disease of bone 2; PDB 2; PDB2; RANK; Receptor activator of NF KB; Receptor activator of NF-KB; receptor activator of nuclear factor kappa B; TNF receptor superfamily member 11a; TNFRSF11A; TNR11_HUMAN; TRANCER; Tumor necrosis factor receptor superfamily member 11a NFKB activator; Tumor necrosis factor receptor superfamily member 11a activator of NFKB; Tumor necrosis factor receptor superfamily member 11A
Target Background
The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptors can interact with various TRAF family proteins, through which this receptor induces the activation of NF-kappa B and MAPK8/JNK. This receptor and its ligand are important regulators of the interaction between T cells and dendritic cells. This receptor is also an essential mediator for osteoclast and lymph node development. Mutations at this locus have been associated with familial expansile osteolysis, autosomal recessive osteopetrosis, and Paget disease of bone. Alternatively spliced transcript variants have been described for this locus.
Notification