-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TNFRSF13C was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human TNFRSF13C (NP_443177.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TNFRSF13C was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human TNFRSF13C (NP_443177.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05738A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TNFRSF13C |
| Target Synonyms | BAFFR; CD268; CVID4; BAFF-R; BROMIX; prolixin; TNFRSF13C | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Daudi, Raji, SU-DHL-1 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human TNFRSF13C (NP_443177.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPGLLFG | Uniprot ID | Q96RJ3 |
Uniprot Id
Q96RJ3
Target Species
Human
Target Name
TNFRSF13C
Target Full Name
Tumor necrosis factor receptor superfamily member 13C
Target Function
B-cell receptor specific for TNFSF13B/TALL1/BAFF/BLyS. Promotes the survival of mature B-cells and the B-cell response.
Target Involvement
Immunodeficiency, common variable, 4 (CVID4)
Target Subcellular Location
Membrane; Single-pass type III membrane protein.
Target Tissue Specificity
Highly expressed in spleen and lymph node, and in resting B-cells. Detected at lower levels in activated B-cells, resting CD4+ T-cells, in thymus and peripheral blood leukocytes.
Target Synonyms
B cell activating factor receptor; B-cell-activating factor receptor; BAFF R; BAFF receptor; BAFF-R; BAFFR; BLyS receptor 3; BlySR3; BR 3; BR3; BROMIX; CD 268; CD268; CD268 antigen; CVID4; MGC138235; OTTHUMP00000028746; Prolixin; TNFRSF 13C; Tnfrsf13c; TR13C_HUMAN; Tumor necrosis factor receptor subunit member 13C; Tumor necrosis factor receptor superfamily member 13C
Target Background
B cell-activating factor (BAFF) enhances B-cell survival in vitro and is a regulator of the peripheral B-cell population. Overexpression of Baff in mice results in mature B-cell hyperplasia and symptoms of systemic lupus erythematosus (SLE). Also, some SLE patients have increased levels of BAFF in serum. Therefore, it has been proposed that abnormally high levels of BAFF may contribute to the pathogenesis of autoimmune diseases by enhancing the survival of autoreactive B cells. The protein encoded by this gene is a receptor for BAFF and is a type III transmembrane protein containing a single extracellular cysteine-rich domain. It is thought that this receptor is the principal receptor required for BAFF-mediated mature B-cell survival.
Notification