Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TNNI3K was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-75 of human TNNI3K (NP_057062.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TNNI3K was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-75 of human TNNI3K (NP_057062.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01935A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TNNI3K |
| Target Synonyms | CARK; CCDD; TNNI3K | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat heart, HepG2, Mouse thymus | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-75 of human TNNI3K (NP_057062.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGNYKSRPTQTCTDEWKKKVSESYVITIERLEDDLQIKEKELTELRNIFGSDEAFSKVNLNYRTENGLSLLHLCC | Uniprot ID | Q59H18 |
Uniprot Id
Q59H18
Target Species
Human
Target Name
TNNI3K
Target Full Name
Serine/threonine-protein kinase TNNI3K
Target Function
May play a role in cardiac physiology.
Target Involvement
Cardiac conduction disease with or without dilated cardiomyopathy (CCDD)
Target Subcellular Location
Nucleus. Cytoplasm. Note=Expressed at lower levels in the cytoplasm.
Target Protein Families
Protein kinase superfamily, TKL Ser/Thr protein kinase family, MAP kinase kinase kinase subfamily
Target Tissue Specificity
Highly expressed in both adult and fetal heart.
Target Synonyms
Cardiac ankyrin repeat kinase; cardiac muscle; Cardiac troponin I-interacting kinase; CARK; CMD1FF; CMD2A; CMH7; cTnl; MGC142099; MGC33828; RCM1; Serine/threonine protein kinase TNN13K; Serine/threonine-protein kinase TNNI3K; TNI3K_HUMAN; TNNC1; TNNI3 interacting kinase; TNNI3-interacting kinase; Tnni3k; Troponin 1
Target Background
This gene encodes a protein that belongs to the MAP kinase kinase kinase (MAPKKK) family of protein kinases. The protein contains ankyrin repeat, protein kinase and serine-rich domains and is thought to play a role in cardiac physiology.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
