Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TOB1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human TOB1 (NP_005740.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TOB1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human TOB1 (NP_005740.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05426A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TOB1 |
| Target Synonyms | TOB; TROB; APRO5; APRO6; PIG49; TROB1; TOB1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human TOB1 (NP_005740.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MQLEIQVALNFIISYLYNKLPRRRVNIFGEELERLLKKKYEGHWYPEKPYKGSGFRCIHIGEKVDPVIEQASKESGLDIDDVRGNLPQDLSVWIDPFEVSYQIGEKGPVKVLYVDDNNENGCELDKEIKNSFNPEAQVFM | Uniprot ID | P50616 |
Uniprot Id
P50616
Target Species
Human
Target Name
TOB1
Target Full Name
Protein Tob1
Target Function
Anti-proliferative protein; the function is mediated by association with deadenylase subunits of the CCR4-NOT complex. Mediates CPEB3-accelerated mRNA deadenylation by binding to CPEB3 and recruiting CNOT7 which leads to target mRNA deadenylation and decay.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
BTG family
Target Tissue Specificity
Ubiquitous.
Target Synonyms
TOB1; TOB; TROB1; Protein Tob1; Transducer of erbB-2 1
Target Background
This gene encodes a member of the transducer of erbB-2 /B-cell translocation gene protein family. Members of this family are anti-proliferative factors that have the potential to regulate cell growth. The encoded protein may function as a tumor suppressor. Alternate splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
