Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TOM1L2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 310-450 of human TOM1L2 (NP_001076437.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TOM1L2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 310-450 of human TOM1L2 (NP_001076437.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07522A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TOM1L2 |
| Form | Liquid | Species Reactivity | Human, Mouse, Rat |
| Isotype | IgG | Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. |
| Purification Method | Affinity purification | Positive Samples | Rat brain, Mouse brain |
| Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 310-450 of human TOM1L2 (NP_001076437.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SGRSVQNASNGVLNEVTEDNLIDLGPGSPAVVSPMVGNTAPPSSLSSQLAGLDLGTESVSGTLSSLQQCNPRDGFDMFAQTRGNSLAEQRKTVTYEDPQAVGGLASALDNRKQSSEGIPVAQPSVMDDIEVWLRTDLKGDD | Uniprot ID | Q6ZVM7 |
Uniprot Id
Q6ZVM7
Target Species
Human
Target Name
TOM1L2
Target Full Name
TOM1-like protein 2
Target Function
Probable role in protein transport. May regulate growth factor-induced mitogenic signaling.
Target Protein Families
TOM1 family
Target Tissue Specificity
Ubiquitously expressed with higher expression in heart and skeletal muscle.
Target Synonyms
FLJ32746; Srebf1; Target of Myb-like protein 2; Target of myb1 like 2; Target of myb1-like 2 (chicken); TM1L2_HUMAN; TOM1; TOM1-like 2; TOM1-like protein 2; TOM1L 2; Tom1l2
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
