Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TOX2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human TOX2 (NP_116272.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TOX2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human TOX2 (NP_116272.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07101A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TOX2 |
| Target Synonyms | GCX1; GCX-1; C20orf100; dJ495O3.1; dJ1108D11.2; TOX2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat lung, Rat thymus, U-251MG, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human TOX2 (NP_116272.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSDGNPELLSTSQTYNGQSENNEDYEIPPITPPNLPEPSLLHLGDHEASYHSLCHGLTPNGLLPAYSYQAMDLPAIMVSNMLAQDSHLLSGQLPTIQEMVHSEVAAYDSGRPGPLLGRPAMLASHMSALSQSQLISQMGI | Uniprot ID | Q96NM4 |
Uniprot Id
Q96NM4
Target Species
Human
Target Name
TOX2
Target Full Name
TOX high mobility group box family member 2
Target Function
Putative transcriptional activator involved in the hypothalamo-pituitary-gonadal system.
Target Subcellular Location
Nucleus.
Target Synonyms
C20orf100; Chromosome 20 open reading frame 100 ; dJ1108D11.2; dJ495O3.1; GCX 1; GCX1; Granulosa cell HMG box protein 1; MGC15880; TOX high mobility group box family member 2; TOX2; TOX2_HUMAN; Weakly similar to NONHISTONE CHROMOSOMAL PROTEIN 6A [S.cerevisiae]
Target Background
Enables transcription coactivator activity. Involved in positive regulation of transcription by RNA polymerase II. Located in nucleoplasm.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
