Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TP53AIP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-108 of human TP53AIP1 (NP_001238893.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TP53AIP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-108 of human TP53AIP1 (NP_001238893.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02619A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TP53AIP1 |
| Target Synonyms | P53AIP1; TP53AIP1 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-108 of human TP53AIP1 (NP_001238893.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGSSSEASFRSAQASCSGARRQGLGRGDQNLSVMPPNGRAQTHTPGWVSPCSENRDGLLPATAPGRLCSHRGADIPSFQTHQDPVTASGSSELHADCPQFRALDRAGN | Uniprot ID | Q9HCN2 |
Uniprot Id
Q9HCN2
Target Species
Human
Target Name
TP53AIP1
Target Full Name
p53-regulated apoptosis-inducing protein 1
Target Function
May play an important role in mediating p53/TP53-dependent apoptosis.
Target Subcellular Location
Mitochondrion.
Target Tissue Specificity
Only found to be expressed in thymus.
Target Research Area
Cell Biology
Target Synonyms
p53 regulated apoptosis inducing protein 1; p53-regulated apoptosis-inducing protein 1; P53AIP 1; p53AIP1; TP53AIP 1; TP53AIP1; TPIP1_HUMAN
Target Background
This gene is specifically expressed in the thymus, and encodes a protein that is localized to the mitochondrion. The expression of this gene is inducible by p53, and it is thought to play an important role in mediating p53-dependent apoptosis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
