-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TPO-R/CD110/c-Mpl was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 295-390 of human TPO-R/CD110/c-Mpl (NP_005364.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against TPO-R/CD110/c-Mpl was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 295-390 of human TPO-R/CD110/c-Mpl (NP_005364.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-06567A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TPO-R/CD110/c-Mpl |
| Target Synonyms | MPLV; TPOR; C-MPL; CD110; THPOR; THCYT2; TPO-R/CD110/c-Mpl | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 295-390 of human TPO-R/CD110/c-Mpl (NP_005364.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DLKNVTCQWQQQDHASSQGFFYHSRARCCPRDRYPIWENCEEEEKTNPGLQTPQFSRCHFKSRNDSIIHILVEVTTAPGTVHSYLGSPFWIHQAVR | Uniprot ID | P40238 |
Uniprot Id
P40238
Target Species
Human
Target Name
MPL
Target Full Name
Thrombopoietin receptor
Target Function
Receptor for thrombopoietin that acts as a primary regulator of megakaryopoiesis and platelet production. May represent a regulatory molecule specific for TPO-R-dependent immune responses.
Target Involvement
Congenital amegakaryocytic thrombocytopenia (CAMT); Thrombocythemia 2 (THCYT2); Myelofibrosis with myeloid metaplasia (MMM)
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein. Golgi apparatus. Cell surface.
Target Protein Families
Type I cytokine receptor family, Type 1 subfamily
Target Tissue Specificity
Expressed at a low level in a large number of cells of hematopoietic origin. Isoform 1 and isoform 2 are always found to be coexpressed.
Target Research Area
Immunology
Target Synonyms
C MPL; CD110; mpl; MPLV; Myeloproliferative leukemia protein; Myeloproliferative leukemia virus oncogene; Proto-oncogene c-Mpl; THCYT2; Thrombopoietin receptor; TPO R; TPO-R; TPOR; TPOR_HUMAN
Target Background
In 1990 an oncogene, v-mpl, was identified from the murine myeloproliferative leukemia virus that was capable of immortalizing bone marrow hematopoietic cells from different lineages. In 1992 the human homologue, named, c-mpl, was cloned. Sequence data revealed that c-mpl encoded a protein that was homologous with members of the hematopoietic receptor superfamily. Presence of anti-sense oligodeoxynucleotides of c-mpl inhibited megakaryocyte colony formation. The ligand for c-mpl, thrombopoietin, was cloned in 1994. Thrombopoietin was shown to be the major regulator of megakaryocytopoiesis and platelet formation. The protein encoded by the c-mpl gene, CD110, is a 635 amino acid transmembrane domain, with two extracellular cytokine receptor domains and two intracellular cytokine receptor box motifs . TPO-R deficient mice were severely thrombocytopenic, emphasizing the important role of CD110 and thrombopoietin in megakaryocyte and platelet formation. Upon binding of thrombopoietin CD110 is dimerized and the JAK family of non-receptor tyrosine kinases, as well as the STAT family, the MAPK family, the adaptor protein Shc and the receptors themselves become tyrosine phosphorylated.
Notification