-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TREML1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 16-162 of human TREML1 (NP_835468.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TREML1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 16-162 of human TREML1 (NP_835468.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06444A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TREML1 |
| Target Synonyms | TLT1; TLT-1; PRO3438; GLTL1825; dJ238O23.3; TREML1 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, Mouse lung, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 16-162 of human TREML1 (NP_835468.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QGIVGSLPEVLQAPVGSSILVQCHYRLQDVKAQKVWCRFLPEGCQPLVSSAVDRRAPAGRRTFLTDLGGGLLQVEMVTLQEEDAGEYGCMVDGARGPQILHRVSLNILPPEEEEETHKIGSLAENAFSDPAGSANPLEPSQDEKSIP | Uniprot ID | Q86YW5 |
Uniprot Id
Q86YW5
Target Species
Human
Target Name
TREML1
Target Full Name
Trem-like transcript 1 protein
Target Function
Cell surface receptor that may play a role in the innate and adaptive immune response.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein. Cytoplasm. Note=Sequestered in cytoplasmic vesicles in resting platelets (PubMed:15100151). Transported to the cell surface after stimulation by thrombin (PubMed:15100151). Soluble fragments can be released into the serum by proteolysis (PubMed:16505478).
Target Tissue Specificity
Detected in platelets, monocytic leukemia and in T-cell leukemia.
Target Synonyms
dJ238O23.3; GLTL1825; MGC119173; PRO3438; TLT 1; TLT-1; TLT1; TREM like transcript 1; Trem like transcript 1 protein; Trem-like transcript 1 protein; TREML 1; Treml1; Triggering receptor expressed on myeloid cells like 1; Triggering receptor expressed on myeloid cells like protein 1; Triggering receptor expressed on myeloid cells-like protein 1; TRML1_HUMAN
Target Background
This gene encodes a member of the triggering receptor expressed on myeloid cells-like (TREM) family. The encoded protein is a type 1 single Ig domain orphan receptor localized to the alpha-granule membranes of platelets. The encoded protein is involved in platelet aggregation, inflammation, and cellular activation and has been linked to Gray platelet syndrome. Alternative splicing results in multiple transcript variants
Notification