-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TRIM63 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 253-353 of human TRIM63 (NP_115977.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against TRIM63 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 253-353 of human TRIM63 (NP_115977.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-12743A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TRIM63 |
| Target Synonyms | IRF; SMRZ; MURF1; MURF2; RNF28; TRIM63 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat heart, 293F | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 253-353 of human TRIM63 (NP_115977.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LDKSTKLVETAIQSLDEPGGATFLLTAKQLIKSIVEASKGCQLGKTEQGFENMDFFTLDLEHIADALRAIDFGTDEEEEEFIEEEDQEEEESTEGKEEGHQ | Uniprot ID | Q969Q1 |
Uniprot Id
Q969Q1
Target Species
Human
Target Name
TRIM63
Target Full Name
E3 ubiquitin-protein ligase TRIM63
Target Function
E3 ubiquitin ligase. Mediates the ubiquitination and subsequent proteasomal degradation of CKM, GMEB1 and HIBADH. Regulates the proteasomal degradation of muscle proteins under amino acid starvation, where muscle protein is catabolized to provide other organs with amino acids. Inhibits de novo skeletal muscle protein synthesis under amino acid starvation. Regulates proteasomal degradation of cardiac troponin I/TNNI3 and probably of other sarcomeric-associated proteins. May play a role in striated muscle atrophy and hypertrophy by regulating an anti-hypertrophic PKC-mediated signaling pathway. May regulate the organization of myofibrils through TTN in muscle cells.
Target Subcellular Location
Cytoplasm. Nucleus. Cytoplasm, myofibril, sarcomere, M line. Cytoplasm, myofibril, sarcomere, Z line.
Target Tissue Specificity
Muscle specific. Selectively expressed in heart and skeletal muscle. Also expressed in the iris.
Target Research Area
Cardiovascular
Target Synonyms
E3 ubiquitin-protein ligase TRIM63; FLJ32380; IRF; Iris RING finger protein; MURF 1; MURF-1; MuRF1; MURF2; Muscle specific ring finger protein 1; Muscle specific ring finger protein 2; Muscle-specific RING finger protein 1; OTTHUMP00000008701; RING finger protein 28; RNF 28; RNF28; SMRZ; Striated muscle RING zinc finger protein; TRI63_HUMAN; TRIM 63; Trim63; Tripartite motif containing 63; tripartite motif containing 63, E3 ubiquitin protein ligase; Tripartite motif containing protein 63; Tripartite motif-containing protein 63; Ubiquitin ligase TRIM63
Target Background
This gene encodes a member of the RING zinc finger protein family found in striated muscle and iris. The product of this gene is an E3 ubiquitin ligase that localizes to the Z-line and M-line lattices of myofibrils. This protein plays an important role in the atrophy of skeletal and cardiac muscle and is required for the degradation of myosin heavy chain proteins, myosin light chain, myosin binding protein, and for muscle-type creatine kinase.
Notification