-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TRMT1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 460-659 of human TRMT1 (NP_060192.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TRMT1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 460-659 of human TRMT1 (NP_060192.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02675A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TRMT1 |
| Target Synonyms | TRM1; MRT68; TRMT1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, HL-60, MCF7 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 460-659 of human TRMT1 (NP_060192.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PSLLQLRSALLHADFRVSLSHACKNAVKTDAPASALWDIMRCWEKECPVKRERLSETSPAFRILSVEPRLQANFTIREDANPSSRQRGLKRFQANPEANWGPRPRARPGGKAADEAMEERRRLLQNKRKEPPEDVAQRAARLKTFPCKRFKEGTCQRGDQCCYSHSPPTPRVSADAAPDCPETSNQTPPGPGAAAGPGID | Uniprot ID | Q9NXH9 |
Uniprot Id
Q9NXH9
Target Species
Human
Target Name
TRMT1
Target Full Name
tRNA (guanine(26)-N(2))-dimethyltransferase
Target Function
Dimethylates a single guanine residue at position 26 of most tRNAs using S-adenosyl-L-methionine as donor of the methyl groups.
Target Protein Families
Class I-like SAM-binding methyltransferase superfamily, Trm1 family
Target Synonyms
2)G26)dimethyltransferase; 2-dimethylguanosine-26 methyltransferase; FLJ20244; N(2) N(2) dimethylguanosine tRNA methyltransferase; N(2)-N(2)) methyltransferase; TRM 1; TRM1 tRNA methyltransferase 1 homolog; TRM1_HUMAN; TRMT 1; Trmt1; tRNA (guanine(26)-N(2))-dimethyltransferase; tRNA 2 2 dimethylguanosine 26 methyltransferase; tRNA 2; tRNA(guanine 26 N(2) N(2)) methyltransferase; tRNA(guanine-26; tRNA(m(2 2)G26)dimethyltransferase; tRNA(m(2
Target Background
This gene encodes a tRNA-modifying enzyme that acts as a dimethyltransferase, modifying a single guanine residue at position 26 of the tRNA. The encoded enzyme has both mono- and dimethylase activity when exogenously expressed, and uses S-adenosyl methionine as a methyl donor. The C-terminal region of the encoded protein has both a zinc finger motif, and an arginine/proline-rich region. Mutations in this gene have been implicated in autosomal recessive intellectual disorder (ARID). Alternative splicing results in multiple transcript variants encoding different isoforms. There is a pseudogene of this gene on the X chromosome.
Notification