Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TRMT2A/HTF9C was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 500 to the C-terminus of human TRMT2A/HTF9C (NP_073564.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TRMT2A/HTF9C was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 500 to the C-terminus of human TRMT2A/HTF9C (NP_073564.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02688A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TRMT2A/HTF9C |
| Target Synonyms | HTF9C; TRMT2A/HTF9C | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | K-562 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 500 to the C-terminus of human TRMT2A/HTF9C (NP_073564.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LASQHLVAILDPPRAGLHSKVILAIRRAKNLRRLLYVSCNPRAAMGNFVDLCRAPSNRVKGIPFRPVKAVAVDLFPQTPHCEMLILFERVEHPNGTGVLGPHSPPAQPTPGPPDNTLQETGTFPSS | Uniprot ID | Q8IZ69 |
Uniprot Id
Q8IZ69
Target Species
Human
Target Name
TRMT2A
Target Full Name
tRNA (uracil-5-)-methyltransferase homolog A
Target Function
May be involved in nucleic acid metabolism and/or modifications.
Target Protein Families
Class I-like SAM-binding methyltransferase superfamily, RNA M5U methyltransferase family
Target Synonyms
HpaII tiny fragments locus 9c protein; HTF9C; TRM2 tRNA methyltransferase 2 homolog A (S. cerevisiae); TRM2 tRNA methyltransferase 2 homolog A; TRM2A_HUMAN; TRMT2A; tRNA (uracil-5-)-methyltransferase homolog A; tRNA methyltransferase 2 homolog A; tRNA methyltransferase 2, S. cerevisiae, homolog of, A
Target Background
The protein encoded by this gene is of unknown function. However, it is orthologous to the mouse Trmt2a gene and contains an RNA methyltransferase domain. Expression of this gene varies during the cell cycle, with aberrant expression being a possible biomarker in certain breast cancers. Several transcript variants encoding two different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
