-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TRPM5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1026-1165 of human TRPM5 (NP_055370.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TRPM5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1026-1165 of human TRPM5 (NP_055370.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02329A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TRPM5 |
| Target Synonyms | MTR1; LTRPC5; TRPM5 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain, Mouse liver, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1026-1165 of human TRPM5 (NP_055370.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RVFKKEAEHKREHLERDLPDPLDQKVVTWETVQKENFLSKMEKRRRDSEGEVLRKTAHRVDFIAKYLGGLREQEKRIKCLESQINYCSVLVSSVADVLAQGGGPRSSQHCGEGSQLVAADHRGGLDGWEQPGAGQPPSDT | Uniprot ID | Q9NZQ8 |
Uniprot Id
Q9NZQ8
Target Species
Human
Target Name
TRPM5
Target Full Name
Transient receptor potential cation channel subfamily M member 5
Target Function
Voltage-modulated Ca(2+)-activated, monovalent cation channel (VCAM) that mediates a transient membrane depolarization and plays a central role in taste transduction. Monovalent-specific, non-selective cation channel that mediates the transport of Na(+), K(+) and Cs(+) ions equally well. Activated directly by increases in intracellular Ca(2+), but is impermeable to it. Gating is voltage-dependent and displays rapid activation and deactivation kinetics upon channel stimulation even during sustained elevations in Ca(2+). Also activated by a fast intracellular Ca(2+) increase in response to inositol 1,4,5-triphosphate-producing receptor agonists. The channel is blocked by extracellular acidification. External acidification has 2 effects, a fast reversible block of the current and a slower irreversible enhancement of current inactivation. Is a highly temperature-sensitive, heat activated channel showing a steep increase of inward currents at temperatures between 15 and 35 degrees Celsius. Heat activation is due to a shift of the voltage-dependent activation curve to negative potentials. Activated by arachidonic acid in vitro. May be involved in perception of bitter, sweet and umami tastes. May also be involved in sensing semiochemicals.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
Transient receptor (TC 1.A.4) family, LTrpC subfamily, TRPM5 sub-subfamily
Target Tissue Specificity
Strongly expressed in fetal brain, liver and kidney, and in adult prostate, testis, ovary, colon and peripheral blood leukocytes. Also expressed in a large proportion of Wilms' tumors and rhabdomyosarcomas. In monochromosomal cell lines shows exclusive pa
Target Synonyms
9430099A16Rik; Long transient receptor potential channel 5; LTrpC-5; LTrpC5; MLSN1 and TRP related gene 1; MLSN1 and TRP related gene 1 protein; MLSN1 and TRP-related; MLSN1- and TRP-related gene 1 protein; MTR1; Novel protein similar to vertebrate transient receptor potential cation channel, subfamily M, member 5; Transient receptor potential cation channel subfamily M member 5; Transient receptor potential cation channel, subfamily M, member 5; Trpm5; TRPM5 transient receptor potential cation channel, subfamily M, member 5; TRPM5_HUMAN
Target Background
This gene encodes a member of the transient receptor potential (TRP) protein family, which is a diverse group of proteins with structural features typical of ion channels. This protein plays an important role in taste transduction, and has characteristics of a calcium-activated, non-selective cation channel that carries Na+, K+, and Cs+ ions equally well, but not Ca(2+) ions. It is activated by lower concentrations of intracellular Ca(2+), and inhibited by higher concentrations. It is also a highly temperature-sensitive, heat activated channel showing a steep increase of inward currents at temperatures between 15 and 35 degrees Celsius. This gene is located within the Beckwith-Wiedemann syndrome critical region-1 on chromosome 11p15.5, and has been shown to be imprinted, with exclusive expression from the paternal allele.
Notification