-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TRPM7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 756-855 of human TRPM7 (NP_060142.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TRPM7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 756-855 of human TRPM7 (NP_060142.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06480A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TRPM7 |
| Target Synonyms | CHAK; CHAK1; ALSPDC; LTRPC7; LTrpC-7; TRP-PLIK; TRPM7 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse skeletal muscle | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 756-855 of human TRPM7 (NP_060142.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NSWYKVILSILVPPAILLLEYKTKAEMSHIPQSQDAHQMTMDDSENNFQNITEEIPMEVFKEVRILDSNEGKNEMEIQMKSKKLPITRKFYAFYHAPIVK | Uniprot ID | Q96QT4 |
Uniprot Id
Q96QT4
Target Species
Human
Target Name
TRPM7
Target Full Name
Transient receptor potential cation channel subfamily M member 7
Target Function
Essential ion channel and serine/threonine-protein kinase. Divalent cation channel permeable to calcium and magnesium. Has a central role in magnesium ion homeostasis and in the regulation of anoxic neuronal cell death. Involved in TNF-induced necroptosis downstream of MLKL by mediating calcium influx. The kinase activity is essential for the channel function. May be involved in a fundamental process that adjusts plasma membrane divalent cation fluxes according to the metabolic state of the cell. Phosphorylates annexin A1 (ANXA1).
Target Involvement
Amyotrophic lateral sclerosis-parkinsonism/dementia complex 1 (ALS-PDC1)
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
Protein kinase superfamily, Alpha-type protein kinase family, ALPK subfamily; Transient receptor (TC 1.A.4) family, LTrpC subfamily, TRPM7 sub-subfamily
Target Synonyms
ALSPDC; CHAK; CHAK1; Channel kinase 1; Channel-kinase 1; Long transient receptor potential channel 7; LTrpC-7; LTrpC7; Transient receptor potential cation channel subfamily M member 7; TRP PLIK; TRPM7; TRPM7_HUMAN
Target Background
This gene belongs to the melastatin subfamily of transient receptor potential family of ion channels. The protein encoded by this gene is both an ion channel and a serine/threonine protein kinase. The kinase activity is essential for the ion channel function, which serves to increase intracellular calcium levels and to help regulate magnesium ion homeostasis. The encoded protein is involved in cytoskeletal organization, cell adhesion, cell migration and organogenesis. Defects in this gene are a cause of amyotrophic lateral sclerosis-parkinsonism/dementia complex of Guam. The gene may also be associated with defects of cardiac function.
Notification