Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TSPAN8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 110-200 of human TSPAN8 (NP_004607.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TSPAN8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 110-200 of human TSPAN8 (NP_004607.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03554A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TSPAN8 |
| Target Synonyms | CO-029; TM4SF3; TSPAN8 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung, Rat lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 110-200 of human TSPAN8 (NP_004607.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNGAADWGNNFQHYPELCACLDKQRPCQSYNGKQVYKETCISFIKD | Uniprot ID | P19075 |
Uniprot Id
P19075
Target Species
Human
Target Name
TSPAN8
Target Full Name
Tetraspanin-8
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
Tetraspanin (TM4SF) family
Target Tissue Specificity
Gastric, colon, rectal, and pancreatic carcinomas.
Target Synonyms
TSPAN8; TM4SF3; Tetraspanin-8; Tspan-8; Transmembrane 4 superfamily member 3; Tumor-associated antigen CO-029
Target Background
The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins. This gene is expressed in different carcinomas. The use of alternate polyadenylation sites has been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
