Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TXNDC9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human TXNDC9 (NP_005774.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TXNDC9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human TXNDC9 (NP_005774.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13657A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TXNDC9 |
| Target Synonyms | APACD; PHLP3; C9 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human TXNDC9 (NP_005774.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEADASVDMFSKVLEHQLLQTTKLVEEHLDSEIQKLDQMDEDELERLKEKRLQALRKAQQQKQEWLSKGHGEYREIPSERDFFQEVKESENVVCHFYRDSTFRCKILDRH | Uniprot ID | O14530 |
Uniprot Id
O14530
Target Species
Human
Target Name
TXNDC9
Target Full Name
Thioredoxin domain-containing protein 9
Target Function
Significantly diminishes the chaperonin TCP1 complex ATPase activity, thus negatively impacts protein folding, including that of actin or tubulin.
Target Subcellular Location
Cytoplasm. Nucleus. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Midbody.
Target Synonyms
APACD; ATP binding protein associated with cell differentiation; ATP-binding protein associated with cell differentiation; ES cell related protein; PHLP3; Phosducin like protein 3; Protein 1 4; Protein 1-4; Thioredoxin domain containing 9; Thioredoxin domain containing protein 9; Thioredoxin domain-containing protein 9; TXND9_HUMAN; Txndc9; TXNDC9 protein
Target Background
The protein encoded by this gene is a member of the thioredoxin family. The exact function of this protein is not known but it is associated with cell differentiation.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
