-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against UBA1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 959-1058 of human UBA1 (P22314) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against UBA1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 959-1058 of human UBA1 (P22314) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-14057A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | UBA1 |
| Target Synonyms | A1S9; A1ST; GXP1; UBE1; A1S9T; AMCX1; POC20; SMAX2; UBA1A; UBE1X; VEXAS; CFAP124; UBA1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, K-562, Mouse brain, Mouse spleen, Mouse testis | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 959-1058 of human UBA1 (P22314). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EVQGLQPNGEEMTLKQFLDYFKTEHKLEITMLSQGVSMLYSFFMPAAKLKERLDQPMTEIVSRVSKRKLGRHVRALVLELCCNDESGEDVEVPYVRYTIR | Uniprot ID | P22314 |
Uniprot Id
P22314
Target Species
Human
Target Name
UBA1
Target Full Name
Ubiquitin-like modifier-activating enzyme 1
Target Function
Catalyzes the first step in ubiquitin conjugation to mark cellular proteins for degradation through the ubiquitin-proteasome system. Activates ubiquitin by first adenylating its C-terminal glycine residue with ATP, and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding a ubiquitin-E1 thioester and free AMP. Essential for the formation of radiation-induced foci, timely DNA repair and for response to replication stress. Promotes the recruitment of TP53BP1 and BRCA1 at DNA damage sites.
Target Involvement
Spinal muscular atrophy X-linked 2 (SMAX2)
Target Subcellular Location
Cytoplasm. Mitochondrion. Nucleus.; [Isoform 1]: Nucleus.; [Isoform 2]: Cytoplasm.
Target Protein Families
Ubiquitin-activating E1 family
Target Tissue Specificity
Detected in erythrocytes (at protein level). Ubiquitous.
Target Synonyms
A1S9; A1S9 protein; A1S9T and BN75 temperature sensitivity complementing; A1S9T; A1ST; AMCX1; CFAP124; CTD-2522E6.1; GXP 1; GXP1; MGC4781; POC20; POC20 centriolar protein homolog; Protein A1S9; SMAX2; Uba1; UBA1, ubiquitin-activating enzyme E1 homolog A; UBA1_HUMAN; UBA1A; UBE 1; UBE 1X; UBE1; UBE1X; Ubiquitin activating enzyme E1; Ubiquitin-activating enzyme E1; Ubiquitin-like modifier-activating enzyme 1
Target Background
The protein encoded by this gene catalyzes the first step in ubiquitin conjugation to mark cellular proteins for degradation. This gene complements an X-linked mouse temperature-sensitive defect in DNA synthesis, and thus may function in DNA repair. It is part of a gene cluster on chromosome Xp11.23. Alternatively spliced transcript variants that encode the same protein have been described.
Notification