-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against UBE2C was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 70-150 of human UBE2C (O00762) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against UBE2C was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 70-150 of human UBE2C (O00762) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-13958A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | UBE2C |
| Target Synonyms | UBCH10; dJ447F3.2; UBE2C | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 70-150 of human UBE2C (O00762). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNT | Uniprot ID | O00762 |
Uniprot Id
O00762
Target Species
Human
Target Name
UBE2C
Target Full Name
Ubiquitin-conjugating enzyme E2 C
Target Function
Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'- and 'Lys-48'-linked polyubiquitination. Acts as an essential factor of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated ubiquitin ligase that controls progression through mitosis. Acts by initiating 'Lys-11'-linked polyubiquitin chains on APC/C substrates, leading to the degradation of APC/C substrates by the proteasome and promoting mitotic exit.
Target Protein Families
Ubiquitin-conjugating enzyme family
Target Synonyms
Cyclin selective ubiquitin carrier protein; dJ447F3.2; Mitotic specific ubiquitin conjugating enzyme; UB E2C; UBCH 10; UbcH10; UBE 2C; Ube2c; UBE2C_HUMAN; Ubiquitin carrier protein C; Ubiquitin carrier protein E2 C; Ubiquitin carrier protein E2C; Ubiquitin conjugating enzyme E2 C; Ubiquitin conjugating enzyme E2C; Ubiquitin protein ligase C; Ubiquitin-conjugating enzyme E2 C; Ubiquitin-protein ligase C
Target Background
The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, ubiquitin-conjugating enzymes, and ubiquitin-protein ligases. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein is required for the destruction of mitotic cyclins and for cell cycle progression, and may be involved in cancer progression. Multiple transcript variants encoding different isoforms have been found for this gene. Pseudogenes of this gene have been defined on chromosomes 4, 14, 15, 18, and 19.
Notification