Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against UBE2I was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human UBE2I (P63279) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against UBE2I was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human UBE2I (P63279) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-16065A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | UBE2I |
| Target Synonyms | P18; UBC9; C358B7.1; UBE2I | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse lung, Mouse spleen, Rat testis | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human UBE2I (P63279). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEED | Uniprot ID | P63279 |
Uniprot Id
P63279
Target Species
Human
Target Name
UBE2I
Target Full Name
SUMO-conjugating enzyme UBC9
Target Function
Accepts the ubiquitin-like proteins SUMO1, SUMO2, SUMO3, SUMO4 and SUMO1P1/SUMO5 from the UBLE1A-UBLE1B E1 complex and catalyzes their covalent attachment to other proteins with the help of an E3 ligase such as RANBP2, CBX4 and ZNF451. Can catalyze the formation of poly-SUMO chains. Necessary for sumoylation of FOXL2 and KAT5. Essential for nuclear architecture and chromosome segregation. Sumoylates p53/TP53 at 'Lys-386'. Mediates sumoylation of ERCC6 which is essential for its transcription-coupled nucleotide excision repair activity.
Target Subcellular Location
Nucleus. Cytoplasm.
Target Protein Families
Ubiquitin-conjugating enzyme family
Target Tissue Specificity
Expressed in heart, skeletal muscle, pancreas, kidney, liver, lung, placenta and brain. Also expressed in testis and thymus.
Target Synonyms
C358B7.1; p18; SUMO 1 protein ligase; SUMO conjugating enzyme UBC9; SUMO-conjugating enzyme UBC9; SUMO-protein ligase; SUMO1 protein ligase; UBC9; UBC9_HUMAN; UBCE9; Ube2i; Ubiquitin carrier protein 9; Ubiquitin carrier protein; Ubiquitin carrier protein I; Ubiquitin conjugating enzyme 9; Ubiquitin conjugating enzyme E2I (homologous to yeast UBC9); Ubiquitin conjugating enzyme E2I (UBC9 homolog; yeast); Ubiquitin conjugating enzyme UbcE2A; Ubiquitin like protein SUMO 1 conjugating enzyme; Ubiquitin protein ligase E2I; Ubiquitin-conjugating enzyme E2 I; Ubiquitin-protein ligase I
Target Background
The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. Four alternatively spliced transcript variants encoding the same protein have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
