Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against UBE2J1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human UBE2J1 (NP_057105.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against UBE2J1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human UBE2J1 (NP_057105.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-04794A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | UBE2J1 |
| Target Synonyms | UBC6; UBC6E; Ubc6p; CGI-76; NCUBE1; HSPC153; HSPC205; NCUBE-1; HSU93243; UBE2J1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse kidney, Rat lung | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human UBE2J1 (NP_057105.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | METRYNLKSPAVKRLMKEAAELKDPTDHYHAQPLEDNLFEWHFTVRGPPDSDFDGGVYHGRIVLPPEYPMKPPSIILLTANGRFEVGKKICLSISGHHPE | Uniprot ID | Q9Y385 |
Uniprot Id
Q9Y385
Target Species
Human
Target Name
UBE2J1
Target Full Name
Ubiquitin-conjugating enzyme E2 J1
Target Function
Catalyzes the covalent attachment of ubiquitin to other proteins. Functions in the selective degradation of misfolded membrane proteins from the endoplasmic reticulum (ERAD).
Target Subcellular Location
Endoplasmic reticulum membrane; Single-pass type IV membrane protein.
Target Protein Families
Ubiquitin-conjugating enzyme family
Target Research Area
Cell Biology
Target Synonyms
UBE2J1; NCUBE1; CGI-76; HSPC153; HSPC205; Ubiquitin-conjugating enzyme E2 J1; EC 2.3.2.23; E2 ubiquitin-conjugating enzyme J1; Non-canonical ubiquitin-conjugating enzyme 1; NCUBE-1; Yeast ubiquitin-conjugating enzyme UBC6 homolog E; HsUBC6e
Target Background
The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is located in the membrane of the endoplasmic reticulum (ER) and may contribute to quality control ER-associated degradation by the ubiquitin-proteasome system.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
