-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against UBE2L6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 54-153 of human UBE2L6 (NP_004214.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against UBE2L6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 54-153 of human UBE2L6 (NP_004214.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-15418A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | UBE2L6 |
| Target Synonyms | RIG-B; UBCH8; UBE2L6 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse spleen, Rat liver, U-87MG | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 54-153 of human UBE2L6 (NP_004214.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RISFPPEYPFKPPMIKFTTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRPS | Uniprot ID | O14933 |
Uniprot Id
O14933
Target Species
Human
Target Name
UBE2L6
Target Full Name
Ubiquitin/ISG15-conjugating enzyme E2 L6
Target Function
Catalyzes the covalent attachment of ubiquitin or ISG15 to other proteins. Functions in the E6/E6-AP-induced ubiquitination of p53/TP53. Promotes ubiquitination and subsequent proteasomal degradation of FLT3.
Target Protein Families
Ubiquitin-conjugating enzyme family
Target Tissue Specificity
Present in natural killer cells (at protein level).
Target Synonyms
MGC40331; Retinoic acid induced gene B protein; Retinoic acid-induced gene B protein; RIG B; RIG-B; UB2L6_HUMAN; UBCH 8; UbcH8; UBE2L6; Ubiquitin carrier protein; Ubiquitin carrier protein L6; Ubiquitin conjugating enzyme E2L 6; Ubiquitin protein ligase; Ubiquitin protein ligase L6; Ubiquitin-protein ligase L6; Ubiquitin/ISG15 conjugating enzyme E2 L6; Ubiquitin/ISG15-conjugating enzyme E2 L6
Target Background
The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes (E1s), ubiquitin-conjugating enzymes (E2s) and ubiquitin-protein ligases (E3s). This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is highly similar in primary structure to the enzyme encoded by the UBE2L3 gene. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Notification