Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against UEVLD was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 50-190 of human UEVLD (NP_001284700.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against UEVLD was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 50-190 of human UEVLD (NP_001284700.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10159A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | UEVLD |
| Target Synonyms | ATTP; UEV3; UEVLD | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HT-29, K-562, Mouse brain, Mouse lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 50-190 of human UEVLD (NP_001284700.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KDLLNFTGTIPVMYQGNTYNIPIRFWILDSHPFAPPICFLKPTANMGILVGKHVDAQGRIYLPYLQNWSHPKSVIVGLIKEMIAKFQEELPMYSLSSSDEARQVDLLAYIAKITEGVSDTNSKSWANHENKTVNKITVVGG | Uniprot ID | Q8IX04 |
Uniprot Id
Q8IX04
Target Species
Human
Target Name
UEVLD
Target Full Name
Ubiquitin-conjugating enzyme E2 variant 3
Target Function
Possible negative regulator of polyubiquitination.
Target Protein Families
Ubiquitin-conjugating enzyme family, UEV subfamily; LDH/MDH superfamily
Target Tissue Specificity
Colon, colon carcinoma cell lines, normal cervical epithelium, carcinomas of the uterine cervix and peripheral blood leukocytes.
Target Synonyms
UEVLD; UEV3Ubiquitin-conjugating enzyme E2 variant 3; UEV-3; EV and lactate/malate dehydrogenase domain-containing protein
Target Background
Predicted to enable oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor. Predicted to be involved in several processes, including carbohydrate metabolic process; cellular protein modification process; and protein transport. Located in extracellular exosome.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
