-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ULBP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human ULBP1 (NP_079494.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ULBP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human ULBP1 (NP_079494.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14585A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ULBP1 |
| Target Synonyms | N2DL-1; RAET1I; NKG2DL1; ULBP1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | K-562, Mouse thymus | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human ULBP1 (NP_079494.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAAAASPAFLLCLPLLHLLSGWSRAGWVDTHCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVDF | Uniprot ID | Q9BZM6 |
Uniprot Id
Q9BZM6
Target Species
Human
Target Name
ULBP1
Target Full Name
UL16-binding protein 1
Target Function
Binds and activates the KLRK1/NKG2D receptor, mediating natural killer cell cytotoxicity.
Target Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor. Endoplasmic reticulum.
Target Protein Families
MHC class I family
Target Tissue Specificity
Expressed in T-cells, B-cells, erythroleukemia cell lines and in a wide range of tissues including heart, brain, lung, liver, testis, lymph node, thymus, tonsil and bone marrow. Also found in fetal heart, brain, lung and liver.
Target Synonyms
Alcan beta; ALCAN-beta; N2DL-1; N2DL1; N2DL1_HUMAN; NKG2D ligand 1; NKG2D ligand 1 precursor; NKG2DL1; RAET1I; Retinoic acid early transcript 1I; UL16; UL16 binding protein 1; UL16-binding protein 1; ULBP1
Target Background
The protein encoded by this gene is a ligand of natural killer group 2, member D (NKG2D), an immune system-activating receptor on NK cells and T-cells. Binding of the encoded ligand to NKG2D leads to activation of several signal transduction pathways, including those of JAK2, STAT5, ERK and PI3K kinase/Akt. Also, in cytomegalovirus-infected cells, this ligand binds the UL16 glycoprotein and is prevented from activating the immune system. Three transcript variants encoding different isoforms have been found for this gene.
Notification